Organism Overview: Halobacillus halophilus


 
dnaA protein networkhttps://string-db.org/network/866895.HBHAL_1001Chromosomal replication initiation protein; Plays an important role in the initiation and regulation of chromosomal replication. Binds to the origin of replication; it binds specifically double-s [...]
dnaN protein networkhttps://string-db.org/network/866895.HBHAL_1002DNA polymerase III beta subunit; Confers DNA tethering and processivity to DNA polymerases and other proteins. Acts as a clamp, forming a ring around DNA (a reaction catalyzed by the clamp-loadin [...]
yaaA protein networkhttps://string-db.org/network/866895.HBHAL_1004Hypothetical protein.
recF protein networkhttps://string-db.org/network/866895.HBHAL_1005DNA replication and repair protein RecF; The RecF protein is involved in DNA metabolism; it is required for DNA replication and normal SOS inducibility. RecF binds preferentially to single-strand [...]
yaaB protein networkhttps://string-db.org/network/866895.HBHAL_1006Hypothetical protein.
gyrB protein networkhttps://string-db.org/network/866895.HBHAL_1007DNA gyrase subunit B; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...]
gyrA protein networkhttps://string-db.org/network/866895.HBHAL_1008DNA gyrase subunit A; A type II topoisomerase that negatively supercoils closed circular double-stranded (ds) DNA in an ATP-dependent manner to modulate DNA topology and maintain chromosomes in a [...]
CCG43396.1 protein networkhttps://string-db.org/network/866895.HBHAL_1009Probable metal dependent phosphohydrolase.
yaaC protein networkhttps://string-db.org/network/866895.HBHAL_1010Hypothetical protein.
guaB protein networkhttps://string-db.org/network/866895.HBHAL_1011IMP dehydrogenase; Catalyzes the conversion of inosine 5'-phosphate (IMP) to xanthosine 5'-phosphate (XMP), the first committed and rate-limiting step in the de novo synthesis of guanine nucleoti [...]
dacA protein networkhttps://string-db.org/network/866895.HBHAL_1012Serine-type D-Ala-D-Ala carboxypeptidase; Belongs to the peptidase S11 family.
pdxS protein networkhttps://string-db.org/network/866895.HBHAL_1013Pyridoxine biosynthesis protein; Catalyzes the formation of pyridoxal 5'-phosphate from ribose 5-phosphate (RBP), glyceraldehyde 3-phosphate (G3P) and ammonia. The ammonia is provided by the PdxT [...]
pdxT protein networkhttps://string-db.org/network/866895.HBHAL_1014Glutamine amidotransferase subunit PdxT; Catalyzes the hydrolysis of glutamine to glutamate and ammonia as part of the biosynthesis of pyridoxal 5'-phosphate. The resulting ammonia molecule is ch [...]
serS protein networkhttps://string-db.org/network/866895.HBHAL_1015seryl-tRNA synthetase; Catalyzes the attachment of serine to tRNA(Ser). Is also able to aminoacylate tRNA(Sec) with serine, to form the misacylated tRNA L- seryl-tRNA(Sec), which will be further [...]
CCG43403.1 protein networkhttps://string-db.org/network/866895.HBHAL_1016Deoxynucleoside kinase.
dgk protein networkhttps://string-db.org/network/866895.HBHAL_1017Deoxyguanosine kinase.
CCG43405.1 protein networkhttps://string-db.org/network/866895.HBHAL_1019ABC-type transport system ATP-binding protein (probable substrate molybdate).
CCG43406.1 protein networkhttps://string-db.org/network/866895.HBHAL_1020ABC-type transport system permease protein (probable substrate molybdate); Part of the binding-protein-dependent transport system for molybdenum; probably responsible for the translocation of the [...]
CCG43407.1 protein networkhttps://string-db.org/network/866895.HBHAL_1021ABC-type transport system extracellular binding protein (probable substrate molybdate).
CCG43408.1 protein networkhttps://string-db.org/network/866895.HBHAL_1022Conserved hypothetical protein.
CCG43410.1 protein networkhttps://string-db.org/network/866895.HBHAL_1024Hypothetical protein.
CCG43411.1 protein networkhttps://string-db.org/network/866895.HBHAL_1025Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
CCG43412.1 protein networkhttps://string-db.org/network/866895.HBHAL_1026Aminoglycoside N3'-acetyltransferase.
queF protein networkhttps://string-db.org/network/866895.HBHAL_10277-cyano-7-deazaguanine reductase; Catalyzes the NADPH-dependent reduction of 7-cyano-7- deazaguanine (preQ0) to 7-aminomethyl-7-deazaguanine (preQ1). Belongs to the GTP cyclohydrolase I family. Q [...]
acsA protein networkhttps://string-db.org/network/866895.HBHAL_1028acetyl-CoA synthetase.
CCG43415.1 protein networkhttps://string-db.org/network/866895.HBHAL_1029Xanthine/uracil permease family protein.
CCG43416.1 protein networkhttps://string-db.org/network/866895.HBHAL_1030Monooxygenase (probable substrate lysine/ornithine).
CCG43417.1 protein networkhttps://string-db.org/network/866895.HBHAL_1031ThiJ/PfpI domain protein.
CCG43418.1 protein networkhttps://string-db.org/network/866895.HBHAL_1032Hypothetical protein.
CCG43419.1 protein networkhttps://string-db.org/network/866895.HBHAL_1033Hypothetical protein.
CCG43420.1 protein networkhttps://string-db.org/network/866895.HBHAL_1034Spore germination protein.
yaaJ protein networkhttps://string-db.org/network/866895.HBHAL_1035Hypothetical protein; Catalyzes the deamination of adenosine to inosine at the wobble position 34 of tRNA(Arg2); Belongs to the cytidine and deoxycytidylate deaminase family.
dnaX protein networkhttps://string-db.org/network/866895.HBHAL_1036DNA polymerase III gamma/tau subunit; DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' [...]
yaaK protein networkhttps://string-db.org/network/866895.HBHAL_1037Conserved hypothetical protein; Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection.
recR protein networkhttps://string-db.org/network/866895.HBHAL_1038Recombination protein RecR; May play a role in DNA repair. It seems to be involved in an RecBC-independent recombinational process of DNA repair. It may act with RecF and RecO.
CCG43425.1 protein networkhttps://string-db.org/network/866895.HBHAL_1039Hypothetical protein.
CCG43426.1 protein networkhttps://string-db.org/network/866895.HBHAL_1040Inhibitor of the pro-sigma K processing machinery.
CCG43427.1 protein networkhttps://string-db.org/network/866895.HBHAL_1043Lysine decarboxylase.
tmk protein networkhttps://string-db.org/network/866895.HBHAL_1044Thymidylate kinase; Phosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis; Belongs to the thymidylate kinase family.
yaaQ protein networkhttps://string-db.org/network/866895.HBHAL_1045Hypothetical protein.
yaaR protein networkhttps://string-db.org/network/866895.HBHAL_1046Conserved hypothetical protein.
holB protein networkhttps://string-db.org/network/866895.HBHAL_1047DNA polymerase III delta' subunit.
CCG43432.1 protein networkhttps://string-db.org/network/866895.HBHAL_1048Hypothetical protein.
yabA protein networkhttps://string-db.org/network/866895.HBHAL_1049DNA replication intiation control protein YabA; Involved in initiation control of chromosome replication. Belongs to the YabA family.
yabB protein networkhttps://string-db.org/network/866895.HBHAL_1050Hypothetical protein.
yazA protein networkhttps://string-db.org/network/866895.HBHAL_1051UPF0213 family protein.
rsmI protein networkhttps://string-db.org/network/866895.HBHAL_105216S rRNA cytidine-2'-O-methyltransferase RsmI; Catalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA.
abrB protein networkhttps://string-db.org/network/866895.HBHAL_1053Transition state regulatory protein AbrB.
metS protein networkhttps://string-db.org/network/866895.HBHAL_1054methionyl-tRNA synthetase; Is required not only for elongation of protein synthesis but also for the initiation of all mRNA translation through initiator tRNA(fMet) aminoacylation.
tatD protein networkhttps://string-db.org/network/866895.HBHAL_1055Deoxyribonuclease, TatD family.
CCG43440.1 protein networkhttps://string-db.org/network/866895.HBHAL_1056Conserved hypothetical protein.
rnmV protein networkhttps://string-db.org/network/866895.HBHAL_1057Ribonuclease M5; Required for correct processing of both the 5' and 3' ends of 5S rRNA precursor. Cleaves both sides of a double-stranded region yielding mature 5S rRNA in one step.
ksgA protein networkhttps://string-db.org/network/866895.HBHAL_1058Dimethyladenosine transferase; Specifically dimethylates two adjacent adenosines (A1518 and A1519) in the loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S particle. May play a c [...]
CCG43443.1 protein networkhttps://string-db.org/network/866895.HBHAL_1059Sporulation-specific protease.
veg protein networkhttps://string-db.org/network/866895.HBHAL_1060Hypothetical protein.
CCG43445.1 protein networkhttps://string-db.org/network/866895.HBHAL_1061Small acid-soluble spore protein.
ispE protein networkhttps://string-db.org/network/866895.HBHAL_10624-diphosphocytidyl-2-C-methyl-D- erythritolkinase; Catalyzes the phosphorylation of the position 2 hydroxy group of 4-diphosphocytidyl-2C-methyl-D-erythritol.
purR protein networkhttps://string-db.org/network/866895.HBHAL_1063Purine operon repressor.
spoVG protein networkhttps://string-db.org/network/866895.HBHAL_1064Regulatory protein SpoVG; Could be involved in septation.
gcaD protein networkhttps://string-db.org/network/866895.HBHAL_1065UDP-N-acetylglucosamine diphosphorylase; Catalyzes the last two sequential reactions in the de novo biosynthetic pathway for UDP-N-acetylglucosamine (UDP-GlcNAc). The C- terminal domain catalyzes [...]
prs1 protein networkhttps://string-db.org/network/866895.HBHAL_1066Ribose-phosphate pyrophosphokinase; Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hy [...]
rplY protein networkhttps://string-db.org/network/866895.HBHAL_106750S ribosomal protein L25; This is one of the proteins that binds to the 5S RNA in the ribosome where it forms part of the central protuberance. Belongs to the bacterial ribosomal protein bL25 fa [...]
pth protein networkhttps://string-db.org/network/866895.HBHAL_1068peptidyl-tRNA hydrolase; The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis. Belongs to the PTH family.
yabK protein networkhttps://string-db.org/network/866895.HBHAL_1069Hypothetical protein.
mfd protein networkhttps://string-db.org/network/866895.HBHAL_1070Transcription-repair coupling factor; Couples transcription and DNA repair by recognizing RNA polymerase (RNAP) stalled at DNA lesions. Mediates ATP-dependent release of RNAP and its truncated tr [...]
CCG43455.1 protein networkhttps://string-db.org/network/866895.HBHAL_1071Stage V sporulation protein T.
CCG43456.1 protein networkhttps://string-db.org/network/866895.HBHAL_1072Putative polysaccharide biosynthesis protein.
yabN protein networkhttps://string-db.org/network/866895.HBHAL_1073Tetrapyrrole methylase family protein / MazG family protein.
yabO protein networkhttps://string-db.org/network/866895.HBHAL_1074S4 domain protein.
CCG43459.1 protein networkhttps://string-db.org/network/866895.HBHAL_1075Hypothetical protein.
CCG43460.1 protein networkhttps://string-db.org/network/866895.HBHAL_1076IS231-type transposase.
CCG43461.1 protein networkhttps://string-db.org/network/866895.HBHAL_1077Conserved hypothetical protein.
CCG43462.1 protein networkhttps://string-db.org/network/866895.HBHAL_1078Conserved hypothetical protein.
CCG43463.1 protein networkhttps://string-db.org/network/866895.HBHAL_1079Cell-division initiation protein.
CCG43464.1 protein networkhttps://string-db.org/network/866895.HBHAL_1080rp-S1 RNA binding domain protein.
hemL protein networkhttps://string-db.org/network/866895.HBHAL_1081Glutamate-1-semialdehyde 2,1-aminomutase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
CCG43466.1 protein networkhttps://string-db.org/network/866895.HBHAL_1082Stage II sporulation protein E.
CCG43467.1 protein networkhttps://string-db.org/network/866895.HBHAL_1083Conserved hypothetical protein.
yabT protein networkhttps://string-db.org/network/866895.HBHAL_1084Serine/threonine-protein kinase.
tilS protein networkhttps://string-db.org/network/866895.HBHAL_1085tRNA(Ile)-lysidine synthetase; Ligates lysine onto the cytidine present at position 34 of the AUA codon-specific tRNA(Ile) that contains the anticodon CAU, in an ATP-dependent manner. Cytidine is [...]
hprT protein networkhttps://string-db.org/network/866895.HBHAL_1086Hypoxanthine-guanine phosphoribosyltransferase; Belongs to the purine/pyrimidine phosphoribosyltransferase family.
ftsH protein networkhttps://string-db.org/network/866895.HBHAL_1087ATP-dependent metalloprotease FtsH; Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane [...]
coaX protein networkhttps://string-db.org/network/866895.HBHAL_1088Pantothenate kinase; Catalyzes the phosphorylation of pantothenate (Pan), the first step in CoA biosynthesis.
hslO protein networkhttps://string-db.org/network/866895.HBHAL_1089HSP33-like chaperonin; Redox regulated molecular chaperone. Protects both thermally unfolding and oxidatively damaged proteins from irreversible aggregation. Plays an important role in the bacter [...]
cysK1 protein networkhttps://string-db.org/network/866895.HBHAL_1090Cysteine synthase; Belongs to the cysteine synthase/cystathionine beta- synthase family.
folP protein networkhttps://string-db.org/network/866895.HBHAL_1091Dihydropteroate synthase; Catalyzes the condensation of para-aminobenzoate (pABA) with 6-hydroxymethyl-7,8-dihydropterin diphosphate (DHPt-PP) to form 7,8- dihydropteroate (H2Pte), the immediate [...]
folB protein networkhttps://string-db.org/network/866895.HBHAL_1092Dihydroneopterin aldolase; Catalyzes the conversion of 7,8-dihydroneopterin to 6- hydroxymethyl-7,8-dihydropterin.
folK protein networkhttps://string-db.org/network/866895.HBHAL_10932-amino-4-hydroxy-6- hydroxymethyldihydropteridinepyrophosphokinase.
lysS protein networkhttps://string-db.org/network/866895.HBHAL_1094lysyl-tRNA synthetase; Belongs to the class-II aminoacyl-tRNA synthetase family.
CCG43479.1 protein networkhttps://string-db.org/network/866895.HBHAL_1098Putative MgtC family transporter (probable substrate magnesium).
ctsR protein networkhttps://string-db.org/network/866895.HBHAL_1099Transcription regulator CtsR; Belongs to the CtsR family.
CCG43481.1 protein networkhttps://string-db.org/network/866895.HBHAL_1100Hypothetical protein.
mcsB protein networkhttps://string-db.org/network/866895.HBHAL_1101Putative ATP:guanido phosphotransferase; Catalyzes the specific phosphorylation of arginine residues in a large number of proteins. Is part of the bacterial stress response system. Protein argini [...]
clpC protein networkhttps://string-db.org/network/866895.HBHAL_1102ATP-dependent Clp protease ATP-binding subunit ClpC; Belongs to the ClpA/ClpB family.
radA protein networkhttps://string-db.org/network/866895.HBHAL_1103DNA repair protein RadA; DNA-dependent ATPase involved in processing of recombination intermediates, plays a role in repairing DNA breaks. Stimulates the branch migration of RecA-mediated strand [...]
disA protein networkhttps://string-db.org/network/866895.HBHAL_1104DNA integrity scanning protein DisA; Has also diadenylate cyclase activity, catalyzing the condensation of 2 ATP molecules into cyclic di-AMP (c-di-AMP). c-di-AMP acts as a signaling molecule tha [...]
yacL protein networkhttps://string-db.org/network/866895.HBHAL_1105Hypothetical protein.
ispD protein networkhttps://string-db.org/network/866895.HBHAL_11062-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Bifunctional enzyme that catalyzes the formation of 4- diphosphocytidyl-2-C-methyl-D-erythritol from CTP and 2-C-methyl-D- erythritol 4-p [...]
gltX protein networkhttps://string-db.org/network/866895.HBHAL_1107glutamyl-tRNA synthetase; Catalyzes the attachment of glutamate to tRNA(Glu) in a two- step reaction: glutamate is first activated by ATP to form Glu-AMP and then transferred to the acceptor end [...]
cysE protein networkhttps://string-db.org/network/866895.HBHAL_1108Serine O-acetyltransferase.
cysS protein networkhttps://string-db.org/network/866895.HBHAL_1109cysteinyl-tRNA synthetase; Belongs to the class-I aminoacyl-tRNA synthetase family.
mrnC protein networkhttps://string-db.org/network/866895.HBHAL_1110Ribonuclease MrnC; Involved in correct processing of both the 5' and 3' ends of 23S rRNA precursor. Processes 30S rRNA precursor transcript even in absence of ribonuclease 3 (Rnc); Rnc processes [...]
CCG43492.1 protein networkhttps://string-db.org/network/866895.HBHAL_1111RNA methyltransferase, TrmH family, group 3; Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.
yacP protein networkhttps://string-db.org/network/866895.HBHAL_1112Conserved hypothetical protein.
sigH protein networkhttps://string-db.org/network/866895.HBHAL_1113RNA polymerase sigma factor SigH; Belongs to the sigma-70 factor family.
rpmG1 protein networkhttps://string-db.org/network/866895.HBHAL_111450S ribosomal protein L33; Belongs to the bacterial ribosomal protein bL33 family.
secE protein networkhttps://string-db.org/network/866895.HBHAL_1115Hypothetical protein; Essential subunit of the Sec protein translocation channel SecYEG. Clamps together the 2 halves of SecY. May contact the channel plug during translocation.
nusG protein networkhttps://string-db.org/network/866895.HBHAL_1116Transcription antitermination protein NusG; Participates in transcription elongation, termination and antitermination.
rplK protein networkhttps://string-db.org/network/866895.HBHAL_111750S ribosomal protein L11; Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors.
rplA protein networkhttps://string-db.org/network/866895.HBHAL_111850S ribosomal protein L1; Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release.
rplJ protein networkhttps://string-db.org/network/866895.HBHAL_111950S ribosomal protein L10; Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. Belongs to the universal ribosomal prot [...]
rplL protein networkhttps://string-db.org/network/866895.HBHAL_112050S ribosomal protein L7/L12; Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation; Belongs to the ba [...]
CCG43502.1 protein networkhttps://string-db.org/network/866895.HBHAL_1121Putative 16S rRNA methyltransferase.
rpoB protein networkhttps://string-db.org/network/866895.HBHAL_1122DNA-directed RNA polymerase beta subunit; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
rpoC protein networkhttps://string-db.org/network/866895.HBHAL_1123DNA-directed RNA polymerase beta' subunit; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
rplGB protein networkhttps://string-db.org/network/866895.HBHAL_1124L7Ae-like ribosome-associated protein.
rpsL protein networkhttps://string-db.org/network/866895.HBHAL_112530S ribosomal protein S12; Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S an [...]
rpsG protein networkhttps://string-db.org/network/866895.HBHAL_112630S ribosomal protein S7; One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit inte [...]
fusA protein networkhttps://string-db.org/network/866895.HBHAL_1127Translation elongation factor G; Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) [...]
tuf protein networkhttps://string-db.org/network/866895.HBHAL_1128Translation elongation factor Tu; This protein promotes the GTP-dependent binding of aminoacyl- tRNA to the A-site of ribosomes during protein biosynthesis.
rpsJ protein networkhttps://string-db.org/network/866895.HBHAL_112930S ribosomal protein S10; Involved in the binding of tRNA to the ribosomes. Belongs to the universal ribosomal protein uS10 family.
rplC protein networkhttps://string-db.org/network/866895.HBHAL_113050S ribosomal protein L3; One of the primary rRNA binding proteins, it binds directly near the 3'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit; Belongs to the universal rib [...]
rplD protein networkhttps://string-db.org/network/866895.HBHAL_113150S ribosomal protein L4; Forms part of the polypeptide exit tunnel.
rplW protein networkhttps://string-db.org/network/866895.HBHAL_113250S ribosomal protein L23; One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main dock [...]
rplB protein networkhttps://string-db.org/network/866895.HBHAL_113350S ribosomal protein L2; One of the primary rRNA binding proteins. Required for association of the 30S and 50S subunits to form the 70S ribosome, for tRNA binding and peptide bond formation. It [...]
rpsS protein networkhttps://string-db.org/network/866895.HBHAL_113430S ribosomal protein S19; Protein S19 forms a complex with S13 that binds strongly to the 16S ribosomal RNA.
rplV protein networkhttps://string-db.org/network/866895.HBHAL_113550S ribosomal protein L22; The globular domain of the protein is located near the polypeptide exit tunnel on the outside of the subunit, while an extended beta-hairpin is found that lines the wal [...]
rpsC protein networkhttps://string-db.org/network/866895.HBHAL_113630S ribosomal protein S3; Binds the lower part of the 30S subunit head. Binds mRNA in the 70S ribosome, positioning it for translation; Belongs to the universal ribosomal protein uS3 family.
rplP protein networkhttps://string-db.org/network/866895.HBHAL_113750S ribosomal protein L16; Binds 23S rRNA and is also seen to make contacts with the A and possibly P site tRNAs; Belongs to the universal ribosomal protein uL16 family.
rpmC protein networkhttps://string-db.org/network/866895.HBHAL_113850S ribosomal protein L29; Belongs to the universal ribosomal protein uL29 family.
rpsQ protein networkhttps://string-db.org/network/866895.HBHAL_113930S ribosomal protein S17; One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.
rplN protein networkhttps://string-db.org/network/866895.HBHAL_114050S ribosomal protein L14; Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome; Belongs to the universal ribosomal protein uL14 family.
rplX protein networkhttps://string-db.org/network/866895.HBHAL_114150S ribosomal protein L24; One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit.
rplE protein networkhttps://string-db.org/network/866895.HBHAL_114250S ribosomal protein L5; This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance [...]
rpsZ protein networkhttps://string-db.org/network/866895.HBHAL_114330S ribosomal protein S14 type Z; Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.
rpsH protein networkhttps://string-db.org/network/866895.HBHAL_114430S ribosomal protein S8; One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit; Belongs to [...]
rplF protein networkhttps://string-db.org/network/866895.HBHAL_114550S ribosomal protein L6; This protein binds to the 23S rRNA, and is important in its secondary structure. It is located near the subunit interface in the base of the L7/L12 stalk, and near the t [...]
rplR protein networkhttps://string-db.org/network/866895.HBHAL_114650S ribosomal protein L18; This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protubera [...]
rpsE protein networkhttps://string-db.org/network/866895.HBHAL_114730S ribosomal protein S5; Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body. Belongs to the universal ribosomal protein uS5 fam [...]
rpmD protein networkhttps://string-db.org/network/866895.HBHAL_114850S ribosomal protein L30.
rplO protein networkhttps://string-db.org/network/866895.HBHAL_114950S ribosomal protein L15; Binds to the 23S rRNA; Belongs to the universal ribosomal protein uL15 family.
secY protein networkhttps://string-db.org/network/866895.HBHAL_1150Preprotein translocase subunit SecY; The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at t [...]
adk protein networkhttps://string-db.org/network/866895.HBHAL_1151Adenylate kinase; Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Plays an important role in cellular energy homeostasis and in adenine nucleotide metabolis [...]
map1 protein networkhttps://string-db.org/network/866895.HBHAL_1152Methionine aminopeptidase; Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharg [...]
CCG43534.1 protein networkhttps://string-db.org/network/866895.HBHAL_1153Hypothetical protein.
infA protein networkhttps://string-db.org/network/866895.HBHAL_1154Translation initiation factor IF-1; One of the essential components for the initiation of protein synthesis. Stabilizes the binding of IF-2 and IF-3 on the 30S subunit to which N-formylmethionyl- [...]
rpmJ protein networkhttps://string-db.org/network/866895.HBHAL_115550S ribosomal protein L36; Belongs to the bacterial ribosomal protein bL36 family.
rpsM protein networkhttps://string-db.org/network/866895.HBHAL_115630S ribosomal protein S13; Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 [...]
rpsK protein networkhttps://string-db.org/network/866895.HBHAL_115730S ribosomal protein S11; Located on the platform of the 30S subunit, it bridges several disparate RNA helices of the 16S rRNA. Forms part of the Shine- Dalgarno cleft in the 70S ribosome; Belon [...]
rpoA protein networkhttps://string-db.org/network/866895.HBHAL_1158DNA-directed RNA polymerase alpha subunit; DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
rplQ protein networkhttps://string-db.org/network/866895.HBHAL_115950S ribosomal protein L17.
ecfA protein networkhttps://string-db.org/network/866895.HBHAL_1160ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel); ATP-binding (A) component of a common energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC tr [...]
ecfA-2 protein networkhttps://string-db.org/network/866895.HBHAL_1161ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel); ATP-binding (A) component of a common energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC tr [...]
ecfT protein networkhttps://string-db.org/network/866895.HBHAL_1162ABC-type transport system permease protein (probable substrate cobalt/nickel); Transmembrane (T) component of an energy-coupling factor (ECF) ABC-transporter complex. Unlike classic ABC transport [...]
truA protein networkhttps://string-db.org/network/866895.HBHAL_1163tRNA pseudouridine synthase A; Formation of pseudouridine at positions 38, 39 and 40 in the anticodon stem and loop of transfer RNAs.
rplM protein networkhttps://string-db.org/network/866895.HBHAL_116450S ribosomal protein L13; This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages [...]
rpsI protein networkhttps://string-db.org/network/866895.HBHAL_116530S ribosomal protein S9; Belongs to the universal ribosomal protein uS9 family.
CCG43547.1 protein networkhttps://string-db.org/network/866895.HBHAL_1166Hypothetical protein.
CCG43548.1 protein networkhttps://string-db.org/network/866895.HBHAL_1167Hypothetical protein.
cwlD protein networkhttps://string-db.org/network/866895.HBHAL_1168N-acetylmuramoyl-L-alanine amidase.
CCG43550.1 protein networkhttps://string-db.org/network/866895.HBHAL_1169ATP-binding Mrp-like protein; Binds and transfers iron-sulfur (Fe-S) clusters to target apoproteins. Can hydrolyze ATP; Belongs to the Mrp/NBP35 ATP-binding proteins family.
CCG43551.1 protein networkhttps://string-db.org/network/866895.HBHAL_1170Spore germination protein.
kbaA protein networkhttps://string-db.org/network/866895.HBHAL_1171KinB signaling pathway activation protein.
CCG43553.1 protein networkhttps://string-db.org/network/866895.HBHAL_1172Polysaccharide deacetylase.
CCG43554.1 protein networkhttps://string-db.org/network/866895.HBHAL_1173Hypothetical protein.
rocF protein networkhttps://string-db.org/network/866895.HBHAL_1176Arginase; Belongs to the arginase family.
CCG43556.1 protein networkhttps://string-db.org/network/866895.HBHAL_1177Hypothetical protein.
sigW protein networkhttps://string-db.org/network/866895.HBHAL_1178RNA polymerase sigma factor SigW; Belongs to the sigma-70 factor family. ECF subfamily.
ybbM protein networkhttps://string-db.org/network/866895.HBHAL_1179Hypothetical protein.
ybbP protein networkhttps://string-db.org/network/866895.HBHAL_1180Hypothetical protein; Catalyzes the condensation of 2 ATP molecules into cyclic di- AMP (c-di-AMP), a second messenger used to regulate differing processes in different bacteria.
ybbR protein networkhttps://string-db.org/network/866895.HBHAL_1181Hypothetical protein.
glmM protein networkhttps://string-db.org/network/866895.HBHAL_1182Phosphoglucosamine mutase; Catalyzes the conversion of glucosamine-6-phosphate to glucosamine-1-phosphate; Belongs to the phosphohexose mutase family.
glmS protein networkhttps://string-db.org/network/866895.HBHAL_1183Glucosamine--fructose-6-phosphate aminotransferase; Catalyzes the first step in hexosamine metabolism, converting fructose-6P into glucosamine-6P using glutamine as a nitrogen source.
CCG43563.1 protein networkhttps://string-db.org/network/866895.HBHAL_1184Thioredoxin-disulfide reductase.
CCG43564.1 protein networkhttps://string-db.org/network/866895.HBHAL_1185M24 family peptidase.
CCG43565.1 protein networkhttps://string-db.org/network/866895.HBHAL_1186GntR family transcription regulator.
yfhO protein networkhttps://string-db.org/network/866895.HBHAL_1187Hypothetical protein.
CCG43567.1 protein networkhttps://string-db.org/network/866895.HBHAL_1188Hypothetical protein.
csbB protein networkhttps://string-db.org/network/866895.HBHAL_1189Probable glycosyltransferase CsbB.
CCG43569.1 protein networkhttps://string-db.org/network/866895.HBHAL_1190Putative esterase.
CCG43570.1 protein networkhttps://string-db.org/network/866895.HBHAL_1191MutT/NUDIX family protein; Belongs to the Nudix hydrolase family.
flaR protein networkhttps://string-db.org/network/866895.HBHAL_1193Locus_tag: HBHAL_1192; product: acetyltransferase, GNAT family (nonfunctional); gene has an in-frame stop codon; conceptual translation after in silico reconstruction: MLNSWKGSPIYLREIVEEDWQTVHSYA [...]
CCG43573.1 protein networkhttps://string-db.org/network/866895.HBHAL_1194ABC-type transport system ATP-binding/permease protein.
CCG43574.1 protein networkhttps://string-db.org/network/866895.HBHAL_1195ABC-type transport system ATP-binding/permease protein.
CCG43575.1 protein networkhttps://string-db.org/network/866895.HBHAL_1196Hypothetical protein.
CCG43576.1 protein networkhttps://string-db.org/network/866895.HBHAL_1197Metallo-beta-lactamase family protein.
CCG43577.1 protein networkhttps://string-db.org/network/866895.HBHAL_1198Hypothetical protein.
CCG43578.1 protein networkhttps://string-db.org/network/866895.HBHAL_1199Oxidoreductase, DadA family.
CCG43579.1 protein networkhttps://string-db.org/network/866895.HBHAL_1200Glyoxalase domain protein.
CCG43580.1 protein networkhttps://string-db.org/network/866895.HBHAL_1201ThiJ/PfpI domain protein.
CCG43581.1 protein networkhttps://string-db.org/network/866895.HBHAL_1202ArsR family transcription regulator.
CCG43582.1 protein networkhttps://string-db.org/network/866895.HBHAL_1203Cation-transporting ATPase (probable substrate cadmium).
murE-2 protein networkhttps://string-db.org/network/866895.HBHAL_1204UDP-N-acetylmuramyl-tripeptide synthetase; Catalyzes the addition of an amino acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (UMAG) in the biosynthesis of bacterial ce [...]
CCG43584.1 protein networkhttps://string-db.org/network/866895.HBHAL_1205Hypothetical protein.
CCG43585.1 protein networkhttps://string-db.org/network/866895.HBHAL_1206Bifunctional riboflavin kinase / FMN adenylyltransferase; Belongs to the ribF family.
CCG43586.1 protein networkhttps://string-db.org/network/866895.HBHAL_1207Conserved hypothetical protein.
CCG43587.1 protein networkhttps://string-db.org/network/866895.HBHAL_1208Hypothetical protein.
CCG43588.1 protein networkhttps://string-db.org/network/866895.HBHAL_1210IS150-type transposase orfAB.
CCG43589.1 protein networkhttps://string-db.org/network/866895.HBHAL_1211Conserved hypothetical protein.
CCG43590.1 protein networkhttps://string-db.org/network/866895.HBHAL_1212Hypothetical protein.
CCG43591.1 protein networkhttps://string-db.org/network/866895.HBHAL_1213Aldo/keto reductase family protein.
CCG43592.1 protein networkhttps://string-db.org/network/866895.HBHAL_1214Methyl-accepting chemotaxis protein.
CCG43593.1 protein networkhttps://string-db.org/network/866895.HBHAL_1215Hypothetical protein.
uvsE1 protein networkhttps://string-db.org/network/866895.HBHAL_1217UV damage endonuclease; Component in a DNA repair pathway. Removal of UV-light damaged nucleotides. Recognizes pyrimidine dimers and cleave a phosphodiester bond immediately 5' to the lesion.
guaD protein networkhttps://string-db.org/network/866895.HBHAL_1218Guanine deaminase.
CCG43596.1 protein networkhttps://string-db.org/network/866895.HBHAL_1219CDP-alcohol phosphatidyltransferase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
CCG43597.1 protein networkhttps://string-db.org/network/866895.HBHAL_1220Cell wall hydrolase.
CCG43598.1 protein networkhttps://string-db.org/network/866895.HBHAL_1221Alanine or glycine/cation symporter (AGCS) family protein.
CCG43599.1 protein networkhttps://string-db.org/network/866895.HBHAL_1222Hypothetical protein.
CCG43600.1 protein networkhttps://string-db.org/network/866895.HBHAL_1223Hypothetical protein.
ilvB1 protein networkhttps://string-db.org/network/866895.HBHAL_1224Acetolactate synthase large subunit; Belongs to the TPP enzyme family.
CCG43602.1 protein networkhttps://string-db.org/network/866895.HBHAL_1225Diguanylate cyclase domain protein / diguanylate phosphodiesterase domain protein.
CCG43603.1 protein networkhttps://string-db.org/network/866895.HBHAL_1226Group II intron reverse transcriptase/maturase.
CCG43604.1 protein networkhttps://string-db.org/network/866895.HBHAL_1227ABC-type transport system extracellular binding protein (probable substrate ferrichrome).
CCG43605.1 protein networkhttps://string-db.org/network/866895.HBHAL_1228ABC-type transport system permease protein (probable substrate ferrichrome); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.
CCG43606.1 protein networkhttps://string-db.org/network/866895.HBHAL_1229ABC-type transport system permease protein (probable substrate ferrichrome); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.
CCG43607.1 protein networkhttps://string-db.org/network/866895.HBHAL_1230ferredoxin--NADP reductase.
CCG43608.1 protein networkhttps://string-db.org/network/866895.HBHAL_1231Conserved hypothetical protein.
glsA1 protein networkhttps://string-db.org/network/866895.HBHAL_1232Glutaminase; Belongs to the glutaminase family.
ythB protein networkhttps://string-db.org/network/866895.HBHAL_1233Cytochrome d ubiquinol oxidase subunit II.
ythA protein networkhttps://string-db.org/network/866895.HBHAL_1234Cytochrome d ubiquinol oxidase subunit I.
CCG43612.1 protein networkhttps://string-db.org/network/866895.HBHAL_1235Methyltransferase.
ileS protein networkhttps://string-db.org/network/866895.HBHAL_1236isoleucyl-tRNA synthetase; Catalyzes the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such e [...]
CCG43614.1 protein networkhttps://string-db.org/network/866895.HBHAL_1237YqiR family transcription regulator.
CCG43615.1 protein networkhttps://string-db.org/network/866895.HBHAL_1238Hypothetical protein.
CCG43616.1 protein networkhttps://string-db.org/network/866895.HBHAL_12394-aminobutyrate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
CCG43618.1 protein networkhttps://string-db.org/network/866895.HBHAL_1241Conserved hypothetical protein.
nadA protein networkhttps://string-db.org/network/866895.HBHAL_1242Quinolinate synthetase; Catalyzes the condensation of iminoaspartate with dihydroxyacetone phosphate to form quinolinate.
nadC protein networkhttps://string-db.org/network/866895.HBHAL_1243Nicotinate-nucleotide pyrophosphorylase; Belongs to the NadC/ModD family.
nadB protein networkhttps://string-db.org/network/866895.HBHAL_1244L-aspartate oxidase; Catalyzes the oxidation of L-aspartate to iminoaspartate.
CCG43622.1 protein networkhttps://string-db.org/network/866895.HBHAL_1245Cysteine desulfurase.
CCG43623.1 protein networkhttps://string-db.org/network/866895.HBHAL_1246TrkH family transporter (probable function potassium uptake).
CCG43624.1 protein networkhttps://string-db.org/network/866895.HBHAL_1247ABC-type transport system ATP-binding protein (probable substrate ferrichrome).
mscL protein networkhttps://string-db.org/network/866895.HBHAL_1248Large-conductance mechanosensitive channel; Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within th [...]
CCG43627.1 protein networkhttps://string-db.org/network/866895.HBHAL_1250Hypothetical protein.
CCG43628.1 protein networkhttps://string-db.org/network/866895.HBHAL_1251MFS-type transporter (probable function multidrug resistance protein).
yphP protein networkhttps://string-db.org/network/866895.HBHAL_1252Hypothetical protein; Belongs to the UPF0403 family.
ypgR protein networkhttps://string-db.org/network/866895.HBHAL_1253Hypothetical protein.
CCG43631.1 protein networkhttps://string-db.org/network/866895.HBHAL_1254ABC-type transport system ATP-binding protein.
CCG43632.1 protein networkhttps://string-db.org/network/866895.HBHAL_1255Probable ABC-type transport system permease protein.
CCG43633.1 protein networkhttps://string-db.org/network/866895.HBHAL_1256Conserved hypothetical protein.
CCG43634.1 protein networkhttps://string-db.org/network/866895.HBHAL_1257Hypothetical protein.
CCG43635.1 protein networkhttps://string-db.org/network/866895.HBHAL_1258Hypothetical protein.
CCG43636.1 protein networkhttps://string-db.org/network/866895.HBHAL_1259Formate/nitrite transporter.
ygaJ protein networkhttps://string-db.org/network/866895.HBHAL_1260S51 family peptidase; Belongs to the peptidase S51 family.
CCG43638.1 protein networkhttps://string-db.org/network/866895.HBHAL_1261Hypothetical protein.
CCG43639.1 protein networkhttps://string-db.org/network/866895.HBHAL_1262Hypothetical protein.
mta protein networkhttps://string-db.org/network/866895.HBHAL_1263GlnR/MerR family transcription regulator Mta.
CCG43641.1 protein networkhttps://string-db.org/network/866895.HBHAL_1264Hypothetical protein.
CCG43642.1 protein networkhttps://string-db.org/network/866895.HBHAL_1265Hypothetical protein.
yocH2 protein networkhttps://string-db.org/network/866895.HBHAL_1266Conserved hypothetical protein.
yocH3 protein networkhttps://string-db.org/network/866895.HBHAL_1267Conserved hypothetical protein.
yocH4 protein networkhttps://string-db.org/network/866895.HBHAL_1268Conserved hypothetical protein.
CCG43646.1 protein networkhttps://string-db.org/network/866895.HBHAL_1269NADPH-dependent FMN reductase.
CCG43647.1 protein networkhttps://string-db.org/network/866895.HBHAL_1270Acetyltransferase, GNAT family.
CCG43648.1 protein networkhttps://string-db.org/network/866895.HBHAL_1271Hypothetical protein.
CCG43649.1 protein networkhttps://string-db.org/network/866895.HBHAL_1272Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG43650.1 protein networkhttps://string-db.org/network/866895.HBHAL_1273Hypothetical protein.
CCG43651.1 protein networkhttps://string-db.org/network/866895.HBHAL_1274UPF0118 family protein.
yubC protein networkhttps://string-db.org/network/866895.HBHAL_1275Hypothetical protein.
CCG43653.1 protein networkhttps://string-db.org/network/866895.HBHAL_1276Probable drug/metabolite exporter.
CCG43654.1 protein networkhttps://string-db.org/network/866895.HBHAL_1277Acetyltransferase, GNAT family.
CCG43655.1 protein networkhttps://string-db.org/network/866895.HBHAL_1278Hypothetical protein.
CCG43656.1 protein networkhttps://string-db.org/network/866895.HBHAL_1279LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family.
CCG43657.1 protein networkhttps://string-db.org/network/866895.HBHAL_1280Hypothetical protein.
CCG43658.1 protein networkhttps://string-db.org/network/866895.HBHAL_1281Hypothetical protein.
CCG43659.1 protein networkhttps://string-db.org/network/866895.HBHAL_1282MFS-type transporter.
CCG43660.1 protein networkhttps://string-db.org/network/866895.HBHAL_1283LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family.
ykjH protein networkhttps://string-db.org/network/866895.HBHAL_1284Conserved hypothetical protein.
pfyP protein networkhttps://string-db.org/network/866895.HBHAL_1285Blue-light photoreceptor.
CCG43663.1 protein networkhttps://string-db.org/network/866895.HBHAL_1286Putative acyl-CoA dehydrogenase.
CCG43664.1 protein networkhttps://string-db.org/network/866895.HBHAL_1287IS150-type transposase orfAB.
yraA protein networkhttps://string-db.org/network/866895.HBHAL_1289Intracellular protease, PfpI family.
CCG43666.1 protein networkhttps://string-db.org/network/866895.HBHAL_1290Conserved hypothetical protein.
CCG43667.1 protein networkhttps://string-db.org/network/866895.HBHAL_1291Hypothetical protein.
CCG43668.1 protein networkhttps://string-db.org/network/866895.HBHAL_1292AB hydrolase superfamily protein.
sco2 protein networkhttps://string-db.org/network/866895.HBHAL_1293Cytochrome c oxidase assembly protein Sco.
yvaM protein networkhttps://string-db.org/network/866895.HBHAL_1294AB hydrolase superfamily protein.
CCG43671.1 protein networkhttps://string-db.org/network/866895.HBHAL_1295Hypothetical protein.
CCG43672.1 protein networkhttps://string-db.org/network/866895.HBHAL_1296Hypothetical protein.
CCG43673.1 protein networkhttps://string-db.org/network/866895.HBHAL_1297Hypothetical protein.
CCG43674.1 protein networkhttps://string-db.org/network/866895.HBHAL_1298Hypothetical protein.
CCG43675.1 protein networkhttps://string-db.org/network/866895.HBHAL_1299Alpha/beta fold hydrolase.
CCG43676.1 protein networkhttps://string-db.org/network/866895.HBHAL_1300Hypothetical protein.
CCG43677.1 protein networkhttps://string-db.org/network/866895.HBHAL_1301Hypothetical protein.
CCG43678.1 protein networkhttps://string-db.org/network/866895.HBHAL_1302MutT/NUDIX family protein.
metB1 protein networkhttps://string-db.org/network/866895.HBHAL_1303Cystathionine gamma-synthase.
CCG43680.1 protein networkhttps://string-db.org/network/866895.HBHAL_1304Dicarboxylate/amino acid/cation symporter (DAACS) family protein; Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family.
CCG43681.1 protein networkhttps://string-db.org/network/866895.HBHAL_1305RNA polymerase sigma-24 subunit, ECF subfamily; Belongs to the sigma-70 factor family. ECF subfamily.
CCG43682.1 protein networkhttps://string-db.org/network/866895.HBHAL_1306Hypothetical protein.
CCG43683.1 protein networkhttps://string-db.org/network/866895.HBHAL_1307Hypothetical protein.
CCG43684.1 protein networkhttps://string-db.org/network/866895.HBHAL_1308Hypothetical protein.
CCG43685.1 protein networkhttps://string-db.org/network/866895.HBHAL_1309TetR family transcription regulator.
CCG43686.1 protein networkhttps://string-db.org/network/866895.HBHAL_1310NADPH--cytochrome P450 oxidoreductase.
CCG43687.1 protein networkhttps://string-db.org/network/866895.HBHAL_1311Hypothetical protein.
CCG43688.1 protein networkhttps://string-db.org/network/866895.HBHAL_1312Homolog to isoprenylcysteine carboxyl methyltransferase.
CCG43689.1 protein networkhttps://string-db.org/network/866895.HBHAL_1313Phytoene desaturase.
CCG43690.1 protein networkhttps://string-db.org/network/866895.HBHAL_1314Na+/Ca2+ antiporter family protein.
CCG43691.1 protein networkhttps://string-db.org/network/866895.HBHAL_1315Conserved hypothetical protein.
CCG43692.1 protein networkhttps://string-db.org/network/866895.HBHAL_1317uracil-DNA glycosylase family protein.
CCG43693.1 protein networkhttps://string-db.org/network/866895.HBHAL_1318Hypothetical protein.
CCG43694.1 protein networkhttps://string-db.org/network/866895.HBHAL_1319Hypothetical protein.
nrdB protein networkhttps://string-db.org/network/866895.HBHAL_1320Ribonucleotide-diphosphate reductase beta subunit; Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides; [...]
nrdA protein networkhttps://string-db.org/network/866895.HBHAL_1321Ribonucleotide-diphosphate reductase alpha subunit; Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.
CCG43697.1 protein networkhttps://string-db.org/network/866895.HBHAL_1322Methyltransferase.
CCG43698.1 protein networkhttps://string-db.org/network/866895.HBHAL_1324Conserved hypothetical protein.
ydaG protein networkhttps://string-db.org/network/866895.HBHAL_1325Conserved hypothetical protein.
CCG43700.1 protein networkhttps://string-db.org/network/866895.HBHAL_1326Cation efflux system protein, CDF family.
CCG43701.1 protein networkhttps://string-db.org/network/866895.HBHAL_1327Conserved hypothetical protein.
CCG43702.1 protein networkhttps://string-db.org/network/866895.HBHAL_1328Acetyltransferase, GNAT family.
CCG43703.1 protein networkhttps://string-db.org/network/866895.HBHAL_1329Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
CCG43704.1 protein networkhttps://string-db.org/network/866895.HBHAL_1330Aminotransferase.
CCG43705.1 protein networkhttps://string-db.org/network/866895.HBHAL_1331FAD-dependent oxidoreductase.
nos protein networkhttps://string-db.org/network/866895.HBHAL_1332Nitric-oxide synthase oxygenase subunit; Catalyzes the production of nitric oxide. Belongs to the NOS family. Bacterial NOS oxygenase subfamily.
CCG43707.1 protein networkhttps://string-db.org/network/866895.HBHAL_1333Carbon-nitrogen hydrolase family protein.
CCG43708.1 protein networkhttps://string-db.org/network/866895.HBHAL_1334Two-component sensor histidine kinase.
CCG43709.1 protein networkhttps://string-db.org/network/866895.HBHAL_1335Two-component response regulator, LytT family protein.
cstA1 protein networkhttps://string-db.org/network/866895.HBHAL_1336Carbon starvation protein CstA.
CCG43711.1 protein networkhttps://string-db.org/network/866895.HBHAL_1337Hypothetical protein.
CCG43712.1 protein networkhttps://string-db.org/network/866895.HBHAL_1338Probable lipid kinase (homolog to diacylglycerol kinase).
yjbJ protein networkhttps://string-db.org/network/866895.HBHAL_1340Transglycosylase domain protein.
CCG43715.1 protein networkhttps://string-db.org/network/866895.HBHAL_1341NADH-dependent FMN reductase.
CCG43716.1 protein networkhttps://string-db.org/network/866895.HBHAL_1342Hypothetical protein.
ohrB protein networkhttps://string-db.org/network/866895.HBHAL_1343Organic hydroperoxide resistance protein.
CCG43718.1 protein networkhttps://string-db.org/network/866895.HBHAL_1344Hypothetical protein.
CCG43719.1 protein networkhttps://string-db.org/network/866895.HBHAL_1345Hypothetical protein.
CCG43720.1 protein networkhttps://string-db.org/network/866895.HBHAL_1346Hypothetical protein.
CCG43721.1 protein networkhttps://string-db.org/network/866895.HBHAL_1347IS1341-type transposase.
CCG43722.1 protein networkhttps://string-db.org/network/866895.HBHAL_1349Hypothetical protein.
CCG43723.1 protein networkhttps://string-db.org/network/866895.HBHAL_1350BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family.
CCG43724.1 protein networkhttps://string-db.org/network/866895.HBHAL_1351Acetyltransferase, GNAT family.
CCG43725.1 protein networkhttps://string-db.org/network/866895.HBHAL_1352Hypothetical protein.
CCG43726.1 protein networkhttps://string-db.org/network/866895.HBHAL_1353Conserved hypothetical protein.
CCG43727.1 protein networkhttps://string-db.org/network/866895.HBHAL_1354BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family.
CCG43728.1 protein networkhttps://string-db.org/network/866895.HBHAL_1355Conserved hypothetical protein.
trxA2 protein networkhttps://string-db.org/network/866895.HBHAL_1356Thioredoxin.
CCG43730.1 protein networkhttps://string-db.org/network/866895.HBHAL_1357IS150-type transposase orfAB.
CCG43731.1 protein networkhttps://string-db.org/network/866895.HBHAL_1359Pyridine nucleotide-disulfide oxidoreductase family protein.
CCG43732.1 protein networkhttps://string-db.org/network/866895.HBHAL_1360DedA family protein.
CCG43733.1 protein networkhttps://string-db.org/network/866895.HBHAL_1361ABC-type transport system ATP-binding protein.
CCG43734.1 protein networkhttps://string-db.org/network/866895.HBHAL_1362ABC-type transport system permease protein.
CCG43735.1 protein networkhttps://string-db.org/network/866895.HBHAL_1363ABC-type transport system permease protein.
CCG43736.1 protein networkhttps://string-db.org/network/866895.HBHAL_1364ABC-type transport system extracellular binding protein.
ydaC protein networkhttps://string-db.org/network/866895.HBHAL_1365Conserved hypothetical protein.
CCG43739.1 protein networkhttps://string-db.org/network/866895.HBHAL_1367Luciferase family oxidoreductase.
CCG43740.1 protein networkhttps://string-db.org/network/866895.HBHAL_1368Conserved hypothetical protein.
CCG43741.1 protein networkhttps://string-db.org/network/866895.HBHAL_1369Conserved hypothetical protein.
CCG43742.1 protein networkhttps://string-db.org/network/866895.HBHAL_1370MATE efflux family protein.
CCG43743.1 protein networkhttps://string-db.org/network/866895.HBHAL_1371MarR family transcription regulator.
CCG43744.1 protein networkhttps://string-db.org/network/866895.HBHAL_1372Conserved hypothetical protein.
CCG43745.1 protein networkhttps://string-db.org/network/866895.HBHAL_1373Hypothetical protein.
CCG43746.1 protein networkhttps://string-db.org/network/866895.HBHAL_1374Hypothetical protein.
CCG43747.1 protein networkhttps://string-db.org/network/866895.HBHAL_1375Hypothetical protein.
bmrU protein networkhttps://string-db.org/network/866895.HBHAL_1376Probable lipid kinase BmrU.
CCG43749.1 protein networkhttps://string-db.org/network/866895.HBHAL_1377Probable methyltransferase.
mhqR protein networkhttps://string-db.org/network/866895.HBHAL_1378MarR family transcription regulator.
CCG43751.1 protein networkhttps://string-db.org/network/866895.HBHAL_1379Hypothetical protein.
CCG43752.1 protein networkhttps://string-db.org/network/866895.HBHAL_1380ABC-type transport system ATP-binding protein.
CCG43753.1 protein networkhttps://string-db.org/network/866895.HBHAL_1381Hypothetical protein.
CCG43754.1 protein networkhttps://string-db.org/network/866895.HBHAL_1382Hypothetical protein.
CCG43755.1 protein networkhttps://string-db.org/network/866895.HBHAL_1383Hypothetical protein.
CCG43756.1 protein networkhttps://string-db.org/network/866895.HBHAL_1384Alpha/beta fold hydrolase.
CCG43757.1 protein networkhttps://string-db.org/network/866895.HBHAL_1385MFS-type transporter.
ykuN protein networkhttps://string-db.org/network/866895.HBHAL_1386Flavodoxin.
degV4 protein networkhttps://string-db.org/network/866895.HBHAL_1387DegV family protein.
CCG43760.1 protein networkhttps://string-db.org/network/866895.HBHAL_1388Hypothetical protein.
cshA protein networkhttps://string-db.org/network/866895.HBHAL_1389DEAD-box ATP-dependent RNA helicase CshA; Belongs to the DEAD box helicase family.
CCG43762.1 protein networkhttps://string-db.org/network/866895.HBHAL_1390S54 family peptidase.
acpS protein networkhttps://string-db.org/network/866895.HBHAL_1391Holo-(acyl carrier protein) synthase; Transfers the 4'-phosphopantetheine moiety from coenzyme A to a Ser of acyl-carrier-protein; Belongs to the P-Pant transferase superfamily. AcpS family.
nnrD protein networkhttps://string-db.org/network/866895.HBHAL_1392Hypothetical protein; Bifunctional enzyme that catalyzes the epimerization of the S- and R-forms of NAD(P)HX and the dehydration of the S-form of NAD(P)HX at the expense of ADP, which is converte [...]
ydcC protein networkhttps://string-db.org/network/866895.HBHAL_1393Hypothetical protein.
alr1 protein networkhttps://string-db.org/network/866895.HBHAL_1394Alanine racemase; Catalyzes the interconversion of L-alanine and D-alanine. May also act on other amino acids; Belongs to the alanine racemase family.
ndoAI protein networkhttps://string-db.org/network/866895.HBHAL_1395Antitoxin EndoAI.
ndoA protein networkhttps://string-db.org/network/866895.HBHAL_1396mRNA interferase EndoA; Toxic component of a type II toxin-antitoxin (TA) system.
rsbR3 protein networkhttps://string-db.org/network/866895.HBHAL_1397RsbR family protein.
rsbS protein networkhttps://string-db.org/network/866895.HBHAL_1398Antagonist of RsbT.
rsbT protein networkhttps://string-db.org/network/866895.HBHAL_1399Serine/threonine-protein kinase RsbT.
CCG43772.1 protein networkhttps://string-db.org/network/866895.HBHAL_1400Indirect positive regulator of sigma-B activity.
rsbV protein networkhttps://string-db.org/network/866895.HBHAL_1401anti-sigma-B factor antagonist RsbV; Belongs to the anti-sigma-factor antagonist family.
rsbW protein networkhttps://string-db.org/network/866895.HBHAL_1402Serine-protein kinase RsbW; Negative regulator of sigma-B activity. Phosphorylates and inactivates its specific antagonist protein, RsbV. Upon phosphorylation of RsbV, RsbW is released and binds [...]
sigB protein networkhttps://string-db.org/network/866895.HBHAL_1403RNA polymerase sigma factor SigB; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.
CCG43776.1 protein networkhttps://string-db.org/network/866895.HBHAL_1404Phosphoserine phosphatase.
CCG43777.1 protein networkhttps://string-db.org/network/866895.HBHAL_1405Hypothetical protein.
ydcK protein networkhttps://string-db.org/network/866895.HBHAL_1406SprT-like protein; Belongs to the SprT family.
thiL protein networkhttps://string-db.org/network/866895.HBHAL_1408Thiamine monophosphate kinase; Catalyzes the ATP-dependent phosphorylation of thiamine- monophosphate (TMP) to form thiamine-pyrophosphate (TPP), the active form of vitamin B1; Belongs to the thi [...]
CCG43780.1 protein networkhttps://string-db.org/network/866895.HBHAL_1409Conserved hypothetical protein.
ydiC protein networkhttps://string-db.org/network/866895.HBHAL_1410M22 family peptidase.
rimI protein networkhttps://string-db.org/network/866895.HBHAL_1411Ribosomal-protein-alanine N-acetyltransferase; Acetylates the N-terminal alanine of ribosomal protein S18.
gcp protein networkhttps://string-db.org/network/866895.HBHAL_1412O-sialoglycoprotein endopeptidase; Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. Is involved in t [...]
CCG43784.1 protein networkhttps://string-db.org/network/866895.HBHAL_1413ABC-type transport system ATP-binding protein.
moaC protein networkhttps://string-db.org/network/866895.HBHAL_1414Molybdenum cofactor biosynthesis protein C; Catalyzes the conversion of (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate to cyclic pyranopterin monophosphate (cPMP); Belongs to the MoaC fami [...]
rex protein networkhttps://string-db.org/network/866895.HBHAL_1415Redox-sensing transcriptional repressor Rex; Modulates transcription in response to changes in cellular NADH/NAD(+) redox state.
CCG43787.1 protein networkhttps://string-db.org/network/866895.HBHAL_1416Short-chain dehydrogenase/reductase family protein.
CCG43788.1 protein networkhttps://string-db.org/network/866895.HBHAL_1417MFS-type transporter (probable function drug:H+ antiporter); Belongs to the major facilitator superfamily.
CCG43789.1 protein networkhttps://string-db.org/network/866895.HBHAL_1418Acetyltransferase, GNAT family.
CCG43790.1 protein networkhttps://string-db.org/network/866895.HBHAL_1419Hypothetical protein.
ydiL protein networkhttps://string-db.org/network/866895.HBHAL_1420Probable membrane peptidase YdiL.
groS protein networkhttps://string-db.org/network/866895.HBHAL_1421Co-chaperonin GroES; Binds to Cpn60 in the presence of Mg-ATP and suppresses the ATPase activity of the latter.
groL protein networkhttps://string-db.org/network/866895.HBHAL_1422Chaperonin GroEL; Prevents misfolding and promotes the refolding and proper assembly of unfolded polypeptides generated under stress conditions.
CCG43794.1 protein networkhttps://string-db.org/network/866895.HBHAL_1423Hypothetical protein.
CCG43795.1 protein networkhttps://string-db.org/network/866895.HBHAL_1424Hypothetical protein.
CCG43796.1 protein networkhttps://string-db.org/network/866895.HBHAL_1425Hypothetical protein.
CCG43797.1 protein networkhttps://string-db.org/network/866895.HBHAL_1426Glucosylceramidase; Belongs to the glycosyl hydrolase 30 family.
CCG43798.1 protein networkhttps://string-db.org/network/866895.HBHAL_1427Spore germination protein.
CCG43799.1 protein networkhttps://string-db.org/network/866895.HBHAL_1428Spore germination protein XA.
CCG43800.1 protein networkhttps://string-db.org/network/866895.HBHAL_1429Spore germination protein.
CCG43801.1 protein networkhttps://string-db.org/network/866895.HBHAL_1430Conserved hypothetical protein.
CCG43802.1 protein networkhttps://string-db.org/network/866895.HBHAL_1431Putative citrate transporter.
CCG43803.1 protein networkhttps://string-db.org/network/866895.HBHAL_1432Conserved hypothetical protein.
CCG43804.1 protein networkhttps://string-db.org/network/866895.HBHAL_1433Exopolysaccharide biosynthesis protein.
CCG43805.1 protein networkhttps://string-db.org/network/866895.HBHAL_1434Hypothetical protein.
CCG43806.1 protein networkhttps://string-db.org/network/866895.HBHAL_1435Conserved hypothetical protein.
CCG43807.1 protein networkhttps://string-db.org/network/866895.HBHAL_1436Putative spore coat polysaccharide biosynthesis protein.
CCG43808.1 protein networkhttps://string-db.org/network/866895.HBHAL_1437NAD-dependent epimerase/dehydratase family protein.
CCG43809.1 protein networkhttps://string-db.org/network/866895.HBHAL_1437_AGlutamine--scyllo-inositol aminotransferase; Belongs to the DegT/DnrJ/EryC1 family.
CCG43810.1 protein networkhttps://string-db.org/network/866895.HBHAL_1438Putative polysaccharide biosynthesis protein.
CCG43811.1 protein networkhttps://string-db.org/network/866895.HBHAL_1439Acetyltransferase, GNAT family.
CCG43812.1 protein networkhttps://string-db.org/network/866895.HBHAL_1440N-acylneuraminate-9-phosphate synthase.
CCG43813.1 protein networkhttps://string-db.org/network/866895.HBHAL_1441Acylneuraminate cytidylyltransferase.
CCG43814.1 protein networkhttps://string-db.org/network/866895.HBHAL_1442General stress protein.
yvnB protein networkhttps://string-db.org/network/866895.HBHAL_1443Hypothetical protein.
CCG43816.1 protein networkhttps://string-db.org/network/866895.HBHAL_1444Conserved hypothetical protein.
CCG43817.1 protein networkhttps://string-db.org/network/866895.HBHAL_1445Hypothetical protein.
gbsU protein networkhttps://string-db.org/network/866895.HBHAL_1446ABC-type transport system extracellular binding protein (probable substrate glycine betaine/proline).
gbsR protein networkhttps://string-db.org/network/866895.HBHAL_1447YuaC family transcription regulator GbsR; Belongs to the GbsR family.
gbsA protein networkhttps://string-db.org/network/866895.HBHAL_1448Glycine betaine aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
CCG43821.1 protein networkhttps://string-db.org/network/866895.HBHAL_1449Hypothetical protein.
gbsB protein networkhttps://string-db.org/network/866895.HBHAL_1450Choline dehydrogenase; Involved in the biosynthesis of the osmoprotectant glycine betaine. Catalyzes the oxidation of choline to betaine aldehyde and betaine aldehyde to glycine betaine at the sa [...]
ahpF protein networkhttps://string-db.org/network/866895.HBHAL_1451Alkyl hydroperoxide reductase subunit F.
CCG43824.1 protein networkhttps://string-db.org/network/866895.HBHAL_1452Peroxiredoxin; Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against [...]
CCG43825.1 protein networkhttps://string-db.org/network/866895.HBHAL_1453Prolyl 4-hydroxylase alpha subunit.
prs2 protein networkhttps://string-db.org/network/866895.HBHAL_1454Ribose-phosphate pyrophosphokinase; Involved in the biosynthesis of the central metabolite phospho-alpha-D-ribosyl-1-pyrophosphate (PRPP) via the transfer of pyrophosphoryl group from ATP to 1-hy [...]
yhfK1 protein networkhttps://string-db.org/network/866895.HBHAL_1455Conserved hypothetical protein.
CCG43828.1 protein networkhttps://string-db.org/network/866895.HBHAL_1456Hypothetical protein.
CCG43830.1 protein networkhttps://string-db.org/network/866895.HBHAL_1458Hypothetical protein.
CCG43831.1 protein networkhttps://string-db.org/network/866895.HBHAL_1459Conserved hypothetical protein.
CCG43832.1 protein networkhttps://string-db.org/network/866895.HBHAL_1460Conserved hypothetical protein.
CCG43834.1 protein networkhttps://string-db.org/network/866895.HBHAL_1462Conserved hypothetical protein.
CCG43835.1 protein networkhttps://string-db.org/network/866895.HBHAL_1463Hypothetical protein.
CCG43836.1 protein networkhttps://string-db.org/network/866895.HBHAL_1464Hypothetical protein.
CCG43837.1 protein networkhttps://string-db.org/network/866895.HBHAL_1465Hypothetical protein.
CCG43838.1 protein networkhttps://string-db.org/network/866895.HBHAL_1466Hypothetical protein.
CCG43839.1 protein networkhttps://string-db.org/network/866895.HBHAL_1467Hypothetical protein.
CCG43840.1 protein networkhttps://string-db.org/network/866895.HBHAL_1468Hypothetical protein.
CCG43841.1 protein networkhttps://string-db.org/network/866895.HBHAL_1469Conserved hypothetical protein.
CCG43842.1 protein networkhttps://string-db.org/network/866895.HBHAL_1470GntR family transcription regulator.
CCG43843.1 protein networkhttps://string-db.org/network/866895.HBHAL_1471Maltose-6'-phosphate glucosidase.
CCG43844.1 protein networkhttps://string-db.org/network/866895.HBHAL_1472PTS system subunit IIA, glucose-specific.
CCG43845.1 protein networkhttps://string-db.org/network/866895.HBHAL_1473Hypothetical protein.
yjaZ protein networkhttps://string-db.org/network/866895.HBHAL_1474Hypothetical protein.
yjcC1 protein networkhttps://string-db.org/network/866895.HBHAL_1475YjcC family transcription regulator.
CCG43848.1 protein networkhttps://string-db.org/network/866895.HBHAL_1476Methyltransferase.
ycbP protein networkhttps://string-db.org/network/866895.HBHAL_1477Hypothetical protein.
ydfS protein networkhttps://string-db.org/network/866895.HBHAL_1478Hypothetical protein.
CCG43851.1 protein networkhttps://string-db.org/network/866895.HBHAL_1479AMT family transporter (probable substrate ammonium).
CCG43852.1 protein networkhttps://string-db.org/network/866895.HBHAL_1480Conserved hypothetical protein.
CCG43853.1 protein networkhttps://string-db.org/network/866895.HBHAL_1481Exonuclease domain protein.
CCG43854.1 protein networkhttps://string-db.org/network/866895.HBHAL_1482Hypothetical protein.
selO protein networkhttps://string-db.org/network/866895.HBHAL_1483Hypothetical protein; Catalyzes the transfer of adenosine 5'-monophosphate (AMP) to Ser, Thr or Tyr residues of target proteins (AMPylation). Belongs to the SELO family.
CCG43856.1 protein networkhttps://string-db.org/network/866895.HBHAL_1484IS1341-type transposase.
CCG43857.1 protein networkhttps://string-db.org/network/866895.HBHAL_1485Spore coat protein X.
CCG43858.1 protein networkhttps://string-db.org/network/866895.HBHAL_1486Spore coat protein X.
CCG43859.1 protein networkhttps://string-db.org/network/866895.HBHAL_1487Hypothetical protein.
CCG43860.1 protein networkhttps://string-db.org/network/866895.HBHAL_1488Putative secreted protein.
CCG43861.1 protein networkhttps://string-db.org/network/866895.HBHAL_1489Hypothetical protein.
CCG43862.1 protein networkhttps://string-db.org/network/866895.HBHAL_1490Glyoxalase/bleomycin resistance protein/dioxygenase.
CCG43863.1 protein networkhttps://string-db.org/network/866895.HBHAL_1491Hypothetical protein.
CCG43864.1 protein networkhttps://string-db.org/network/866895.HBHAL_1492ZIP family transporter (probable substrate divalent heavy-metal cations).
yvbH protein networkhttps://string-db.org/network/866895.HBHAL_1493Hypothetical protein.
CCG43866.1 protein networkhttps://string-db.org/network/866895.HBHAL_1494DUF21/CBS domain protein.
CCG43867.1 protein networkhttps://string-db.org/network/866895.HBHAL_1495FAD-dependent oxidoreductase.
CCG43868.1 protein networkhttps://string-db.org/network/866895.HBHAL_1497IclR family transcription regulator.
CCG43869.1 protein networkhttps://string-db.org/network/866895.HBHAL_14982-dehydro-3-deoxyphosphogluconate aldolase/4-hydroxy-2-oxoglutarate aldolase.
dgoK protein networkhttps://string-db.org/network/866895.HBHAL_14992-keto-3-deoxy-galactonokinase.
dgoA protein networkhttps://string-db.org/network/866895.HBHAL_1500Homolog to galactonate dehydratase.
CCG43872.1 protein networkhttps://string-db.org/network/866895.HBHAL_1501Hypothetical protein.
gntK protein networkhttps://string-db.org/network/866895.HBHAL_1502Gluconate kinase; Belongs to the FGGY kinase family.
CCG43874.1 protein networkhttps://string-db.org/network/866895.HBHAL_1503GntP family transporter (probable substrate gluconate).
CCG43876.1 protein networkhttps://string-db.org/network/866895.HBHAL_1505TetR family transcription regulator.
osmC1 protein networkhttps://string-db.org/network/866895.HBHAL_1506OsmC family protein.
CCG43878.1 protein networkhttps://string-db.org/network/866895.HBHAL_1507Metallo-beta-lactamase family protein.
CCG43879.1 protein networkhttps://string-db.org/network/866895.HBHAL_1508UPF0721 family protein.
CCG43880.1 protein networkhttps://string-db.org/network/866895.HBHAL_1509Conserved hypothetical protein.
CCG43881.1 protein networkhttps://string-db.org/network/866895.HBHAL_1510Hypothetical protein.
CCG43882.1 protein networkhttps://string-db.org/network/866895.HBHAL_1511Hypothetical protein.
CCG43883.1 protein networkhttps://string-db.org/network/866895.HBHAL_1512Allantoate amidohydrolase.
pbpC protein networkhttps://string-db.org/network/866895.HBHAL_1513Penicillin-binding protein 3.
CCG43886.1 protein networkhttps://string-db.org/network/866895.HBHAL_1515Conserved hypothetical protein / HTH domain protein.
CCG43887.1 protein networkhttps://string-db.org/network/866895.HBHAL_1516Hypothetical protein.
CCG43888.1 protein networkhttps://string-db.org/network/866895.HBHAL_1517Hypothetical protein.
ectA protein networkhttps://string-db.org/network/866895.HBHAL_1518L-2,4-diaminobutyric acid acetyltransferase; Catalyzes the acetylation of L-2,4-diaminobutyrate (DABA) to gamma-N-acetyl-alpha,gamma-diaminobutyric acid (ADABA) with acetyl coenzyme A.
ectB protein networkhttps://string-db.org/network/866895.HBHAL_1519Diaminobutyrate--2-oxoglutarate aminotransferase; Catalyzes reversively the conversion of L-aspartate beta- semialdehyde (ASA) to L-2,4-diaminobutyrate (DABA) by transamination with L-glutamate; [...]
ectC protein networkhttps://string-db.org/network/866895.HBHAL_1520L-ectoine synthase; Catalyzes the circularization of gamma-N-acetyl-alpha,gamma- diaminobutyric acid (ADABA) to ectoine (1,4,5,6-tetrahydro-2-methyl-4- pyrimidine carboxylic acid), which is an ex [...]
CCG43892.1 protein networkhttps://string-db.org/network/866895.HBHAL_1522Hypothetical protein.
CCG43893.1 protein networkhttps://string-db.org/network/866895.HBHAL_1523Hypothetical protein.
CCG43894.1 protein networkhttps://string-db.org/network/866895.HBHAL_1524acyl-CoA dehydrogenase.
CCG43895.1 protein networkhttps://string-db.org/network/866895.HBHAL_1525Short-chain dehydrogenase/reductase family protein.
CCG43896.1 protein networkhttps://string-db.org/network/866895.HBHAL_1526Hypothetical protein.
CCG43897.1 protein networkhttps://string-db.org/network/866895.HBHAL_1527MaoC-like dehydratase.
CCG43898.1 protein networkhttps://string-db.org/network/866895.HBHAL_1528acyl-CoA dehydrogenase.
CCG43899.1 protein networkhttps://string-db.org/network/866895.HBHAL_1529Short-chain dehydrogenase/reductase family protein.
CCG43900.1 protein networkhttps://string-db.org/network/866895.HBHAL_1530acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family.
CCG43901.1 protein networkhttps://string-db.org/network/866895.HBHAL_1531TetR family transcription regulator.
CCG43902.1 protein networkhttps://string-db.org/network/866895.HBHAL_1532Conserved hypothetical protein.
CCG43903.1 protein networkhttps://string-db.org/network/866895.HBHAL_1533Short-chain dehydrogenase/reductase family protein.
CCG43904.1 protein networkhttps://string-db.org/network/866895.HBHAL_1534long-chain-fatty-acid--CoA ligase.
CCG43905.1 protein networkhttps://string-db.org/network/866895.HBHAL_1535ABC-type transport system permease protein (probable substrate branched-chain amino acid); Belongs to the binding-protein-dependent transport system permease family.
CCG43906.1 protein networkhttps://string-db.org/network/866895.HBHAL_1536ABC-type transport system permease protein (probable substrate branched-chain amino acid); Belongs to the binding-protein-dependent transport system permease family.
CCG43907.1 protein networkhttps://string-db.org/network/866895.HBHAL_1537ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acid).
CCG43908.1 protein networkhttps://string-db.org/network/866895.HBHAL_1538ABC-type transport system ATP-binding protein (probable substrate branched-chain amino acid).
CCG43909.1 protein networkhttps://string-db.org/network/866895.HBHAL_1539ABC-type transport system substrate-binding protein (probable substrate branched-chain amino acid).
CCG43910.1 protein networkhttps://string-db.org/network/866895.HBHAL_1540acyl-CoA dehydrogenase.
CCG43911.1 protein networkhttps://string-db.org/network/866895.HBHAL_1541long-chain-fatty-acid--CoA ligase.
CCG43912.1 protein networkhttps://string-db.org/network/866895.HBHAL_1542acyl-CoA dehydrogenase.
CCG43913.1 protein networkhttps://string-db.org/network/866895.HBHAL_1543acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family.
CCG43914.1 protein networkhttps://string-db.org/network/866895.HBHAL_1544Hypothetical protein.
CCG43915.1 protein networkhttps://string-db.org/network/866895.HBHAL_1545Thioesterase family protein.
CCG43916.1 protein networkhttps://string-db.org/network/866895.HBHAL_1546Hypothetical protein.
CCG43917.1 protein networkhttps://string-db.org/network/866895.HBHAL_1547Hypothetical protein.
CCG43918.1 protein networkhttps://string-db.org/network/866895.HBHAL_1548AbgT family transporter (probable substrate aminobenzoyl-glutamate).
CCG43919.1 protein networkhttps://string-db.org/network/866895.HBHAL_1549Hypothetical protein.
CCG43920.1 protein networkhttps://string-db.org/network/866895.HBHAL_1550Allantoate amidohydrolase.
CCG43921.1 protein networkhttps://string-db.org/network/866895.HBHAL_1551indole-3-acetyl-L-aspartic acid hydrolase.
CCG43922.1 protein networkhttps://string-db.org/network/866895.HBHAL_1552Putative hydrolase.
CCG43923.1 protein networkhttps://string-db.org/network/866895.HBHAL_1553TrkA-N domain protein.
CCG43924.1 protein networkhttps://string-db.org/network/866895.HBHAL_1554Cold shock protein.
CCG43925.1 protein networkhttps://string-db.org/network/866895.HBHAL_1555Cold shock protein.
phoB protein networkhttps://string-db.org/network/866895.HBHAL_1557Alkaline phosphatase; Belongs to the alkaline phosphatase family.
CCG43927.1 protein networkhttps://string-db.org/network/866895.HBHAL_1558Conserved hypothetical protein.
ytwF protein networkhttps://string-db.org/network/866895.HBHAL_1559Rhodanese domain protein.
CCG43929.1 protein networkhttps://string-db.org/network/866895.HBHAL_1560Polysaccharide deacetylase family protein.
CCG43930.1 protein networkhttps://string-db.org/network/866895.HBHAL_1561Hypothetical protein.
CCG43931.1 protein networkhttps://string-db.org/network/866895.HBHAL_1562ABC-type transport system extracellular binding protein (probable substrate amino acid); Belongs to the bacterial solute-binding protein 3 family.
CCG43932.1 protein networkhttps://string-db.org/network/866895.HBHAL_1563ABC-type transport system permease protein (probable substrate amino acid).
CCG43933.1 protein networkhttps://string-db.org/network/866895.HBHAL_1564ABC-type transport system ATP-binding protein (probable substrate amino acid).
CCG43934.1 protein networkhttps://string-db.org/network/866895.HBHAL_1565Hypothetical protein.
CCG43935.1 protein networkhttps://string-db.org/network/866895.HBHAL_1566Hypothetical protein.
CCG43936.1 protein networkhttps://string-db.org/network/866895.HBHAL_1567Hypothetical protein.
CCG43937.1 protein networkhttps://string-db.org/network/866895.HBHAL_1568Glyoxalase domain protein.
CCG43938.1 protein networkhttps://string-db.org/network/866895.HBHAL_1569Hypothetical protein.
ccdA1 protein networkhttps://string-db.org/network/866895.HBHAL_1570Cytochrome c biogenesis protein CcdA.
yneN protein networkhttps://string-db.org/network/866895.HBHAL_1571Homolog to thioredoxin.
CCG43941.1 protein networkhttps://string-db.org/network/866895.HBHAL_1572Two-component response regulator, OmpR family protein.
CCG43942.1 protein networkhttps://string-db.org/network/866895.HBHAL_1573Two-component sensor histidine kinase.
sodC1 protein networkhttps://string-db.org/network/866895.HBHAL_1574Superoxide dismutase (Cu/Zn).
CCG43944.1 protein networkhttps://string-db.org/network/866895.HBHAL_1575Glutathione-dependent formaldehyde dehydrogenase.
CCG43945.1 protein networkhttps://string-db.org/network/866895.HBHAL_1576Hypothetical protein.
yndN protein networkhttps://string-db.org/network/866895.HBHAL_1577Fosfomycin resistance protein FosB; Metallothiol transferase which confers resistance to fosfomycin by catalyzing the addition of a thiol cofactor to fosfomycin. L-cysteine is probably the physio [...]
CCG43947.1 protein networkhttps://string-db.org/network/866895.HBHAL_1578NRAMP family transporter (probable substrate Mn2+/Fe2+).
CCG43948.1 protein networkhttps://string-db.org/network/866895.HBHAL_1579Carbohydrate kinase; Belongs to the FGGY kinase family.
CCG43949.1 protein networkhttps://string-db.org/network/866895.HBHAL_1580Methanol dehydrogenase regulatory protein.
yeaD protein networkhttps://string-db.org/network/866895.HBHAL_1581Hypothetical protein.
yebA protein networkhttps://string-db.org/network/866895.HBHAL_1582Protease, transglutaminase superfamily.
guaA protein networkhttps://string-db.org/network/866895.HBHAL_1583GMP synthase (glutamine-hydrolysing); Catalyzes the synthesis of GMP from XMP.
CCG43953.1 protein networkhttps://string-db.org/network/866895.HBHAL_1584Putative MFS-type transporter (probable substrate xanthine/uracil).
CCG43954.1 protein networkhttps://string-db.org/network/866895.HBHAL_1585Small heat shock protein; Belongs to the small heat shock protein (HSP20) family.
CCG43955.1 protein networkhttps://string-db.org/network/866895.HBHAL_1586UPF0316 family protein.
CCG43956.1 protein networkhttps://string-db.org/network/866895.HBHAL_1587Conserved hypothetical protein.
purE protein networkhttps://string-db.org/network/866895.HBHAL_1588Phosphoribosylaminoimidazole carboxylase catalytic subunit; Catalyzes the conversion of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to 4-carboxy-5-aminoimidazole ribonucleotide (CAIR).
purK protein networkhttps://string-db.org/network/866895.HBHAL_1589Phosphoribosylaminoimidazole carboxylase ATPase subunit; Catalyzes the ATP-dependent conversion of 5-aminoimidazole ribonucleotide (AIR) and HCO(3)(-) to N5-carboxyaminoimidazole ribonucleotide ( [...]
purB protein networkhttps://string-db.org/network/866895.HBHAL_1590Adenylosuccinate lyase; Belongs to the lyase 1 family. Adenylosuccinate lyase subfamily.
purC protein networkhttps://string-db.org/network/866895.HBHAL_1591Phosphoribosylaminoimidazole-succinocarboxamide synthase; Belongs to the SAICAR synthetase family.
purS protein networkhttps://string-db.org/network/866895.HBHAL_1592Phosphoribosylformylglycinamidine synthase subunit PurS; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent c [...]
purQ protein networkhttps://string-db.org/network/866895.HBHAL_1593Phosphoribosylformylglycinamidine synthase subunit I; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conv [...]
purL protein networkhttps://string-db.org/network/866895.HBHAL_1594Phosphoribosylformylglycinamidine synthase subunit II; Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent con [...]
purF protein networkhttps://string-db.org/network/866895.HBHAL_1595Amidophosphoribosyltransferase; Catalyzes the formation of phosphoribosylamine from phosphoribosylpyrophosphate (PRPP) and glutamine.
purM protein networkhttps://string-db.org/network/866895.HBHAL_1596Phosphoribosylformylglycinamidine cyclo-ligase.
purN protein networkhttps://string-db.org/network/866895.HBHAL_1597Phosphoribosylglycinamide formyltransferase; Catalyzes the transfer of a formyl group from 10- formyltetrahydrofolate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-formylg [...]
purH protein networkhttps://string-db.org/network/866895.HBHAL_1598Bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase.
purD protein networkhttps://string-db.org/network/866895.HBHAL_1599Phosphoribosylamine--glycine ligase; Belongs to the GARS family.
CCG43969.1 protein networkhttps://string-db.org/network/866895.HBHAL_1601Hypothetical protein.
ade1 protein networkhttps://string-db.org/network/866895.HBHAL_1602Adenine deaminase.
CCG43971.1 protein networkhttps://string-db.org/network/866895.HBHAL_1603Conserved hypothetical protein.
CCG43972.1 protein networkhttps://string-db.org/network/866895.HBHAL_1604Conserved hypothetical protein.
thrC1 protein networkhttps://string-db.org/network/866895.HBHAL_1605Threonine synthase.
CCG43974.1 protein networkhttps://string-db.org/network/866895.HBHAL_1606Conserved hypothetical protein.
pcrB protein networkhttps://string-db.org/network/866895.HBHAL_1607Heptaprenylglyceryl phosphate synthase; Prenyltransferase that catalyzes in vivo the transfer of the heptaprenyl moiety of heptaprenyl pyrophosphate (HepPP; 35 carbon atoms) to the C3 hydroxyl of [...]
pcrA1 protein networkhttps://string-db.org/network/866895.HBHAL_1608ATP-dependent DNA helicase PcrA.
ligA protein networkhttps://string-db.org/network/866895.HBHAL_1609NAD-dependent DNA ligase LigA; DNA ligase that catalyzes the formation of phosphodiester linkages between 5'-phosphoryl and 3'-hydroxyl groups in double- stranded DNA using NAD as a coenzyme and [...]
CCG43978.1 protein networkhttps://string-db.org/network/866895.HBHAL_1611Conserved hypothetical protein.
p5cdh1 protein networkhttps://string-db.org/network/866895.HBHAL_16121-pyrroline-5-carboxylate dehydrogenase; Belongs to the aldehyde dehydrogenase family. RocA subfamily.
CCG43980.1 protein networkhttps://string-db.org/network/866895.HBHAL_1613Conserved hypothetical protein.
CCG43981.1 protein networkhttps://string-db.org/network/866895.HBHAL_1614Sodium/proline symporter; Catalyzes the sodium-dependent uptake of extracellular L- proline; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
gatC protein networkhttps://string-db.org/network/866895.HBHAL_1616glutamyl-tRNA amidotransferase subunit C; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in orga [...]
gatA protein networkhttps://string-db.org/network/866895.HBHAL_1617glutamyl-tRNA amidotransferase subunit A; Allows the formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in organisms which lack glutaminyl-tRNA s [...]
gatB protein networkhttps://string-db.org/network/866895.HBHAL_1618glutamyl-tRNA amidotransferase subunit B; Allows the formation of correctly charged Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in orga [...]
dagK protein networkhttps://string-db.org/network/866895.HBHAL_1619Diacylglycerol kinase.
CCG43987.1 protein networkhttps://string-db.org/network/866895.HBHAL_1620RNA methyltransferase; Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA M5U methyltransferase family.
CCG43988.1 protein networkhttps://string-db.org/network/866895.HBHAL_1621Phage integrase domain protein; Belongs to the 'phage' integrase family.
CCG43989.1 protein networkhttps://string-db.org/network/866895.HBHAL_1622Hypothetical protein.
CCG43990.1 protein networkhttps://string-db.org/network/866895.HBHAL_1623Conserved hypothetical protein.
CCG43991.1 protein networkhttps://string-db.org/network/866895.HBHAL_1624SinR/xre family transcription regulator.
CCG43992.1 protein networkhttps://string-db.org/network/866895.HBHAL_1625HTH domain protein.
CCG43993.1 protein networkhttps://string-db.org/network/866895.HBHAL_1626Putative antirepressor.
CCG43994.1 protein networkhttps://string-db.org/network/866895.HBHAL_1627Hypothetical protein.
CCG43995.1 protein networkhttps://string-db.org/network/866895.HBHAL_1628HTH domain protein.
CCG43996.1 protein networkhttps://string-db.org/network/866895.HBHAL_1629DnaD domain protein.
CCG43997.1 protein networkhttps://string-db.org/network/866895.HBHAL_1630Conserved hypothetical protein.
CCG43998.1 protein networkhttps://string-db.org/network/866895.HBHAL_1631Conserved hypothetical protein.
CCG43999.1 protein networkhttps://string-db.org/network/866895.HBHAL_1632Conserved hypothetical protein.
CCG44000.1 protein networkhttps://string-db.org/network/866895.HBHAL_1633Conserved hypothetical protein.
CCG44001.1 protein networkhttps://string-db.org/network/866895.HBHAL_1634Conserved hypothetical protein.
CCG44002.1 protein networkhttps://string-db.org/network/866895.HBHAL_1635Conserved hypothetical protein.
CCG44003.1 protein networkhttps://string-db.org/network/866895.HBHAL_1636Conserved hypothetical protein.
CCG44004.1 protein networkhttps://string-db.org/network/866895.HBHAL_1637Conserved hypothetical protein.
CCG44005.1 protein networkhttps://string-db.org/network/866895.HBHAL_1638Conserved hypothetical protein.
CCG44006.1 protein networkhttps://string-db.org/network/866895.HBHAL_1639Conserved hypothetical protein.
CCG44007.1 protein networkhttps://string-db.org/network/866895.HBHAL_1640Conserved hypothetical protein.
CCG44008.1 protein networkhttps://string-db.org/network/866895.HBHAL_1641Conserved hypothetical protein.
CCG44009.1 protein networkhttps://string-db.org/network/866895.HBHAL_1642Conserved hypothetical protein.
CCG44010.1 protein networkhttps://string-db.org/network/866895.HBHAL_1643Conserved hypothetical protein.
CCG44011.1 protein networkhttps://string-db.org/network/866895.HBHAL_1644Conserved hypothetical protein.
CCG44012.1 protein networkhttps://string-db.org/network/866895.HBHAL_1645Conserved hypothetical protein.
CCG44013.1 protein networkhttps://string-db.org/network/866895.HBHAL_1646Conserved hypothetical protein.
CCG44014.1 protein networkhttps://string-db.org/network/866895.HBHAL_1647Conserved hypothetical protein.
CCG44015.1 protein networkhttps://string-db.org/network/866895.HBHAL_1648Conserved hypothetical protein.
CCG44016.1 protein networkhttps://string-db.org/network/866895.HBHAL_1649Hypothetical protein.
CCG44017.1 protein networkhttps://string-db.org/network/866895.HBHAL_1650Hypothetical protein.
CCG44019.1 protein networkhttps://string-db.org/network/866895.HBHAL_1652Hypothetical protein.
CCG44020.1 protein networkhttps://string-db.org/network/866895.HBHAL_1653Hypothetical protein.
CCG44021.1 protein networkhttps://string-db.org/network/866895.HBHAL_1654Hypothetical protein.
CCG44022.1 protein networkhttps://string-db.org/network/866895.HBHAL_1655Hypothetical protein.
CCG44023.1 protein networkhttps://string-db.org/network/866895.HBHAL_1656Hypothetical protein.
CCG44024.1 protein networkhttps://string-db.org/network/866895.HBHAL_1657Phage integrase domain protein; Belongs to the 'phage' integrase family.
CCG44025.1 protein networkhttps://string-db.org/network/866895.HBHAL_1658Hypothetical protein.
CCG44026.1 protein networkhttps://string-db.org/network/866895.HBHAL_1659Hypothetical protein.
CCG44027.1 protein networkhttps://string-db.org/network/866895.HBHAL_1660Hypothetical protein.
CCG44028.1 protein networkhttps://string-db.org/network/866895.HBHAL_1661Hypothetical protein.
CCG44029.1 protein networkhttps://string-db.org/network/866895.HBHAL_1662Acetyltransferase, GNAT family.
CCG44030.1 protein networkhttps://string-db.org/network/866895.HBHAL_1663Hypothetical protein.
CCG44031.1 protein networkhttps://string-db.org/network/866895.HBHAL_1664Hypothetical protein.
yckC1 protein networkhttps://string-db.org/network/866895.HBHAL_1665RDD domain protein.
CCG44033.1 protein networkhttps://string-db.org/network/866895.HBHAL_1666Conserved hypothetical protein.
CCG44034.1 protein networkhttps://string-db.org/network/866895.HBHAL_1667Group II intron reverse transcriptase/maturase.
CCG44035.1 protein networkhttps://string-db.org/network/866895.HBHAL_1668Hypothetical protein.
CCG44036.1 protein networkhttps://string-db.org/network/866895.HBHAL_1669Hypothetical protein.
katG protein networkhttps://string-db.org/network/866895.HBHAL_1670Catalase/peroxidase HPI; Bifunctional enzyme with both catalase and broad-spectrum peroxidase activity; Belongs to the peroxidase family. Peroxidase/catalase subfamily.
CCG44038.1 protein networkhttps://string-db.org/network/866895.HBHAL_1671Hypothetical protein.
CCG44039.1 protein networkhttps://string-db.org/network/866895.HBHAL_1672Hypothetical protein.
CCG44040.1 protein networkhttps://string-db.org/network/866895.HBHAL_1673Hypothetical protein.
CCG44041.1 protein networkhttps://string-db.org/network/866895.HBHAL_1674Putative methyltransferase.
CCG44042.1 protein networkhttps://string-db.org/network/866895.HBHAL_1675Bile acid/sodium symporter (BASS) family protein.
CCG44043.1 protein networkhttps://string-db.org/network/866895.HBHAL_1676Conserved hypothetical protein.
CCG44044.1 protein networkhttps://string-db.org/network/866895.HBHAL_1677UvrD/REP helicase family protein.
CCG44045.1 protein networkhttps://string-db.org/network/866895.HBHAL_1678Hypothetical protein.
CCG44046.1 protein networkhttps://string-db.org/network/866895.HBHAL_1679Phage replication protein.
phrA protein networkhttps://string-db.org/network/866895.HBHAL_1680Deoxyribodipyrimidine photo-lyase; Belongs to the DNA photolyase family.
yuiD2 protein networkhttps://string-db.org/network/866895.HBHAL_1681Conserved hypothetical protein.
CCG44049.1 protein networkhttps://string-db.org/network/866895.HBHAL_1682Conserved hypothetical protein.
CCG44050.1 protein networkhttps://string-db.org/network/866895.HBHAL_1683Conserved hypothetical protein.
CCG44051.1 protein networkhttps://string-db.org/network/866895.HBHAL_1684Methyltransferase.
CCG44052.1 protein networkhttps://string-db.org/network/866895.HBHAL_1685MFS-type transporter (probable metal-tetracycline-proton antiporter).
CCG44053.1 protein networkhttps://string-db.org/network/866895.HBHAL_1686Conserved hypothetical protein.
CCG44054.1 protein networkhttps://string-db.org/network/866895.HBHAL_1687Conserved hypothetical protein.
yqhA protein networkhttps://string-db.org/network/866895.HBHAL_1688Conserved hypothetical protein.
CCG44056.1 protein networkhttps://string-db.org/network/866895.HBHAL_1689DUF1232 family protein.
CCG44057.1 protein networkhttps://string-db.org/network/866895.HBHAL_1690Conserved hypothetical protein.
CCG44058.1 protein networkhttps://string-db.org/network/866895.HBHAL_1691Betaine-homocysteine S-methyltransferase.
metC1 protein networkhttps://string-db.org/network/866895.HBHAL_1692Cystathionine beta-lyase.
metI protein networkhttps://string-db.org/network/866895.HBHAL_1693Cystathionine gamma-synthase.
CCG44061.1 protein networkhttps://string-db.org/network/866895.HBHAL_1694Hypothetical protein.
CCG44064.1 protein networkhttps://string-db.org/network/866895.HBHAL_16973-oxoacyl-[acyl-carrier protein] reductase.
CCG44065.1 protein networkhttps://string-db.org/network/866895.HBHAL_1698Hypothetical protein.
CCG44066.1 protein networkhttps://string-db.org/network/866895.HBHAL_1699Hypothetical protein.
CCG44067.1 protein networkhttps://string-db.org/network/866895.HBHAL_1701GntR family transcription regulator.
CCG44068.1 protein networkhttps://string-db.org/network/866895.HBHAL_1702ABC-type transport system ATP-binding protein.
CCG44069.1 protein networkhttps://string-db.org/network/866895.HBHAL_1703Conserved hypothetical protein.
CCG44070.1 protein networkhttps://string-db.org/network/866895.HBHAL_1704Hypothetical protein.
yqgS1 protein networkhttps://string-db.org/network/866895.HBHAL_1705yqgS family protein; Belongs to the LTA synthase family.
CCG44072.1 protein networkhttps://string-db.org/network/866895.HBHAL_1706Serine-pyruvate aminotransferase.
CCG44073.1 protein networkhttps://string-db.org/network/866895.HBHAL_1707Hypothetical protein; Belongs to the PlsY family.
CCG44074.1 protein networkhttps://string-db.org/network/866895.HBHAL_1708ABC-type transport system permease protein (probable substrate sulfonate/nitrate/taurine).
CCG44075.1 protein networkhttps://string-db.org/network/866895.HBHAL_1709ABC-type transport system ATP-binding protein (probable substrate sulfonate/nitrate/taurine).
CCG44076.1 protein networkhttps://string-db.org/network/866895.HBHAL_1710ABC-type transport system extracellular binding protein (probable substrate sulfonate/nitrate/taurine).
CCG44077.1 protein networkhttps://string-db.org/network/866895.HBHAL_1711Putative acetytransferase.
dsdA protein networkhttps://string-db.org/network/866895.HBHAL_1712D-serine ammonia-lyase; Belongs to the serine/threonine dehydratase family. DsdA subfamily.
CCG44079.1 protein networkhttps://string-db.org/network/866895.HBHAL_1713Short-chain dehydrogenase/reductase family protein.
CCG44080.1 protein networkhttps://string-db.org/network/866895.HBHAL_1714DASS family transporter (probable function sodium:sulfate symport).
CCG44081.1 protein networkhttps://string-db.org/network/866895.HBHAL_1715MFS-type transporter.
CCG44082.1 protein networkhttps://string-db.org/network/866895.HBHAL_1716Short-chain dehydrogenase/reductase family protein.
CCG44083.1 protein networkhttps://string-db.org/network/866895.HBHAL_1717NERD domain protein.
CCG44084.1 protein networkhttps://string-db.org/network/866895.HBHAL_1718PTS system subunit IIBC,N-acetylglucosamine-specific.
CCG44085.1 protein networkhttps://string-db.org/network/866895.HBHAL_1719Hypothetical protein.
CCG44086.1 protein networkhttps://string-db.org/network/866895.HBHAL_1720N-acetylglucosamine-6-phosphate deacetylase.
nagB protein networkhttps://string-db.org/network/866895.HBHAL_1721Glucosamine-6-phosphate deaminase; Catalyzes the reversible isomerization-deamination of glucosamine 6-phosphate (GlcN6P) to form fructose 6-phosphate (Fru6P) and ammonium ion.
CCG44088.1 protein networkhttps://string-db.org/network/866895.HBHAL_1722GntR family transcription regulator.
CCG44089.1 protein networkhttps://string-db.org/network/866895.HBHAL_1723Hypothetical protein.
CCG44090.1 protein networkhttps://string-db.org/network/866895.HBHAL_1724TetR family transcription regulator.
CCG44091.1 protein networkhttps://string-db.org/network/866895.HBHAL_1725Hypothetical protein.
CCG44092.1 protein networkhttps://string-db.org/network/866895.HBHAL_1726Conserved hypothetical protein.
CCG44093.1 protein networkhttps://string-db.org/network/866895.HBHAL_1727Conserved hypothetical protein.
CCG44094.1 protein networkhttps://string-db.org/network/866895.HBHAL_1728Conserved hypothetical protein.
tnrA protein networkhttps://string-db.org/network/866895.HBHAL_1729Transcription regulator TnrA.
CCG44096.1 protein networkhttps://string-db.org/network/866895.HBHAL_1730Hypothetical protein.
CCG44097.1 protein networkhttps://string-db.org/network/866895.HBHAL_1731UPF0118 family protein.
cypC protein networkhttps://string-db.org/network/866895.HBHAL_1734Cytochrome P450.
rpsN1 protein networkhttps://string-db.org/network/866895.HBHAL_173530S ribosomal protein S14; Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site; Belongs to the un [...]
CCG44101.1 protein networkhttps://string-db.org/network/866895.HBHAL_1736Hypothetical protein.
CCG44102.1 protein networkhttps://string-db.org/network/866895.HBHAL_1737BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family.
CCG44103.1 protein networkhttps://string-db.org/network/866895.HBHAL_1738Hypothetical protein.
CCG44104.1 protein networkhttps://string-db.org/network/866895.HBHAL_1739Oxidoreductase domain protein.
CCG44105.1 protein networkhttps://string-db.org/network/866895.HBHAL_1740Conserved hypothetical protein.
CCG44106.1 protein networkhttps://string-db.org/network/866895.HBHAL_1741Conserved hypothetical protein.
CCG44107.1 protein networkhttps://string-db.org/network/866895.HBHAL_1742Hypothetical protein.
CCG44108.1 protein networkhttps://string-db.org/network/866895.HBHAL_1743Conserved hypothetical protein.
yoeD protein networkhttps://string-db.org/network/866895.HBHAL_1744DNA binding domain, excisionase family.
yabJ protein networkhttps://string-db.org/network/866895.HBHAL_1745RutC family protein YabJ.
CCG44111.1 protein networkhttps://string-db.org/network/866895.HBHAL_1746Hypothetical protein.
cstA2 protein networkhttps://string-db.org/network/866895.HBHAL_1747Carbon starvation protein CstA.
CCG44113.1 protein networkhttps://string-db.org/network/866895.HBHAL_1748Putative peroxiredoxin.
CCG44114.1 protein networkhttps://string-db.org/network/866895.HBHAL_1749Hypothetical protein.
CCG44115.1 protein networkhttps://string-db.org/network/866895.HBHAL_1750Deoxyribonuclease, TatD family, putative.
CCG44116.1 protein networkhttps://string-db.org/network/866895.HBHAL_1751ABC-type transport system ATP-binding protein (probable substrate sulfonate/nitrate/taurine).
CCG44117.1 protein networkhttps://string-db.org/network/866895.HBHAL_1752ABC-type transport system permease protein (probable substrate sulfonate/nitrate/taurine).
CCG44118.1 protein networkhttps://string-db.org/network/866895.HBHAL_1753Hypothetical protein.
CCG44119.1 protein networkhttps://string-db.org/network/866895.HBHAL_1754ABC-type transport system extracellular binding protein (probable substrate sulfonate/nitrate/taurine).
CCG44120.1 protein networkhttps://string-db.org/network/866895.HBHAL_1755Hypothetical protein.
CCG44121.1 protein networkhttps://string-db.org/network/866895.HBHAL_1756Hypothetical protein.
CCG44122.1 protein networkhttps://string-db.org/network/866895.HBHAL_1757FAD-dependent oxidoreductase.
CCG44123.1 protein networkhttps://string-db.org/network/866895.HBHAL_1758C45 family peptidase.
CCG44124.1 protein networkhttps://string-db.org/network/866895.HBHAL_1759Conserved hypothetical protein.
CCG44125.1 protein networkhttps://string-db.org/network/866895.HBHAL_1760Enoyl-(acyl carrier protein) reductase.
gdh2 protein networkhttps://string-db.org/network/866895.HBHAL_1761Glutamate dehydrogenase; Belongs to the Glu/Leu/Phe/Val dehydrogenases family.
CCG44127.1 protein networkhttps://string-db.org/network/866895.HBHAL_1762Hypothetical protein.
CCG44128.1 protein networkhttps://string-db.org/network/866895.HBHAL_1763UPF0182 family protein.
CCG44129.1 protein networkhttps://string-db.org/network/866895.HBHAL_1764Hypothetical protein.
nuc protein networkhttps://string-db.org/network/866895.HBHAL_1765Hypothetical protein.
CCG44131.1 protein networkhttps://string-db.org/network/866895.HBHAL_1766Hypothetical protein.
ppc protein networkhttps://string-db.org/network/866895.HBHAL_1767Phosphoenolpyruvate carboxylase; Forms oxaloacetate, a four-carbon dicarboxylic acid source for the tricarboxylic acid cycle; Belongs to the PEPCase type 1 family.
yvrE protein networkhttps://string-db.org/network/866895.HBHAL_1768Regucalcin family protein.
CCG44134.1 protein networkhttps://string-db.org/network/866895.HBHAL_1769Acetyltransferase, GNAT family.
CCG44135.1 protein networkhttps://string-db.org/network/866895.HBHAL_1770Conserved hypothetical protein.
CCG44136.1 protein networkhttps://string-db.org/network/866895.HBHAL_1771PadR family transcription regulator.
CCG44137.1 protein networkhttps://string-db.org/network/866895.HBHAL_1772Na+/H+ antiporter family protein.
CCG44138.1 protein networkhttps://string-db.org/network/866895.HBHAL_1774Hypothetical protein.
CCG44139.1 protein networkhttps://string-db.org/network/866895.HBHAL_1775Gamma-glutamyltransferase.
CCG44140.1 protein networkhttps://string-db.org/network/866895.HBHAL_1776Chromate transporter.
CCG44141.1 protein networkhttps://string-db.org/network/866895.HBHAL_1777Chromate transporter.
CCG44142.1 protein networkhttps://string-db.org/network/866895.HBHAL_1778Hypothetical protein.
msrA protein networkhttps://string-db.org/network/866895.HBHAL_1779Peptide methionine sulfoxide reductase; Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methioni [...]
eutH protein networkhttps://string-db.org/network/866895.HBHAL_1780Probable ethanolamine transporter.
CCG44145.1 protein networkhttps://string-db.org/network/866895.HBHAL_1781Redoxin.
ykuK protein networkhttps://string-db.org/network/866895.HBHAL_1782Conserved hypothetical protein.
CCG44147.1 protein networkhttps://string-db.org/network/866895.HBHAL_1783Conserved hypothetical protein.
CCG44148.1 protein networkhttps://string-db.org/network/866895.HBHAL_1784Hypothetical protein.
CCG44149.1 protein networkhttps://string-db.org/network/866895.HBHAL_1785Hypothetical protein.
CCG44150.1 protein networkhttps://string-db.org/network/866895.HBHAL_1786MFS-type transporter (probable function drug resistance); Belongs to the major facilitator superfamily.
argS1 protein networkhttps://string-db.org/network/866895.HBHAL_1787arginyl-tRNA synthetase.
ydfR protein networkhttps://string-db.org/network/866895.HBHAL_1788Hypothetical protein.
trxA5 protein networkhttps://string-db.org/network/866895.HBHAL_1789Thioredoxin.
CCG44154.1 protein networkhttps://string-db.org/network/866895.HBHAL_1790Hypothetical protein.
proH protein networkhttps://string-db.org/network/866895.HBHAL_1791Pyrroline-5-carboxylate reductase; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline.
proJ protein networkhttps://string-db.org/network/866895.HBHAL_1792Glutamate 5-kinase; Catalyzes the transfer of a phosphate group to glutamate to form L-glutamate 5-phosphate.
proA protein networkhttps://string-db.org/network/866895.HBHAL_1793Gamma-glutamyl phosphate reductase; Catalyzes the NADPH-dependent reduction of L-glutamate 5- phosphate into L-glutamate 5-semialdehyde and phosphate. The product spontaneously undergoes cyclizat [...]
rsbR1 protein networkhttps://string-db.org/network/866895.HBHAL_1794RsbR family protein.
CCG44159.1 protein networkhttps://string-db.org/network/866895.HBHAL_1795Hypothetical protein.
CCG44160.1 protein networkhttps://string-db.org/network/866895.HBHAL_1796Spore coat protein.
CCG44162.1 protein networkhttps://string-db.org/network/866895.HBHAL_1798Hypothetical protein.
CCG44163.1 protein networkhttps://string-db.org/network/866895.HBHAL_1799acyl-CoA dehydrogenase.
CCG44164.1 protein networkhttps://string-db.org/network/866895.HBHAL_1800Short-chain dehydrogenase/reductase family protein.
CCG44165.1 protein networkhttps://string-db.org/network/866895.HBHAL_18013-hydroxybutyryl-CoA dehydrogenase.
CCG44166.1 protein networkhttps://string-db.org/network/866895.HBHAL_1802Conserved hypothetical protein.
CCG44167.1 protein networkhttps://string-db.org/network/866895.HBHAL_1803Conserved hypothetical protein.
comB protein networkhttps://string-db.org/network/866895.HBHAL_1804Putative 2-phosphosulfolactate phosphatase; Belongs to the ComB family.
CCG44169.1 protein networkhttps://string-db.org/network/866895.HBHAL_1805acyl-CoA dehydrogenase.
CCG44170.1 protein networkhttps://string-db.org/network/866895.HBHAL_1806enoyl-CoA hydratase.
CCG44171.1 protein networkhttps://string-db.org/network/866895.HBHAL_1807NAD(P)H:quinone oxidoreductase.
CCG44172.1 protein networkhttps://string-db.org/network/866895.HBHAL_1808Acetyltransferase, GNAT family.
CCG44173.1 protein networkhttps://string-db.org/network/866895.HBHAL_1809Hypothetical protein.
ydjP protein networkhttps://string-db.org/network/866895.HBHAL_1810AB hydrolase superfamily protein.
ilvE protein networkhttps://string-db.org/network/866895.HBHAL_1811Branched-chain amino acid aminotransferase; Acts on leucine, isoleucine and valine. Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
CCG44176.1 protein networkhttps://string-db.org/network/866895.HBHAL_1812O-methyltransferase.
ycsF protein networkhttps://string-db.org/network/866895.HBHAL_1813UPF0271 family protein; Catalyzes the cleavage of 5-oxoproline to form L-glutamate coupled to the hydrolysis of ATP to ADP and inorganic phosphate.
CCG44178.1 protein networkhttps://string-db.org/network/866895.HBHAL_1814Allophanate hydrolase subunit 2.
CCG44179.1 protein networkhttps://string-db.org/network/866895.HBHAL_1815Allophanate hydrolase subunit 1.
ydaT1 protein networkhttps://string-db.org/network/866895.HBHAL_1816Conserved hypothetical protein.
ydaT2 protein networkhttps://string-db.org/network/866895.HBHAL_1817Conserved hypothetical protein.
CCG44182.1 protein networkhttps://string-db.org/network/866895.HBHAL_1818Hypothetical protein.
CCG44184.1 protein networkhttps://string-db.org/network/866895.HBHAL_1820Putative oxidoreductase.
CCG44185.1 protein networkhttps://string-db.org/network/866895.HBHAL_1821Hypothetical protein.
CCG44186.1 protein networkhttps://string-db.org/network/866895.HBHAL_1822Hypothetical protein.
CCG44187.1 protein networkhttps://string-db.org/network/866895.HBHAL_1823YqiR family transcription regulator.
CCG44188.1 protein networkhttps://string-db.org/network/866895.HBHAL_1824Hypothetical protein.
iadA protein networkhttps://string-db.org/network/866895.HBHAL_1825Isoaspartyl dipeptidase; Catalyzes the hydrolytic cleavage of a subset of L- isoaspartyl (L-beta-aspartyl) dipeptides. Used to degrade proteins damaged by L-isoaspartyl residues formation. Belong [...]
cwlK protein networkhttps://string-db.org/network/866895.HBHAL_1826Peptidoglycan L-alanyl-D-glutamate endopeptidase CwlK.
CCG44192.1 protein networkhttps://string-db.org/network/866895.HBHAL_18282-dehydropantoate 2-reductase; Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid.
CCG44193.1 protein networkhttps://string-db.org/network/866895.HBHAL_1829Hypothetical protein.
CCG44194.1 protein networkhttps://string-db.org/network/866895.HBHAL_1830Conserved hypothetical protein.
mreBH protein networkhttps://string-db.org/network/866895.HBHAL_1831Rod-shape determining protein MreBH.
CCG44196.1 protein networkhttps://string-db.org/network/866895.HBHAL_1832Hypothetical protein.
yflK protein networkhttps://string-db.org/network/866895.HBHAL_1833Hypothetical protein.
CCG44198.1 protein networkhttps://string-db.org/network/866895.HBHAL_1834Putative guanine/cytidine deaminase.
CCG44199.1 protein networkhttps://string-db.org/network/866895.HBHAL_1835Hypothetical protein.
CCG44200.1 protein networkhttps://string-db.org/network/866895.HBHAL_1836ABC-type transport system ATP-binding protein.
CCG44201.1 protein networkhttps://string-db.org/network/866895.HBHAL_1837ABC-type transport system permease protein.
CCG44202.1 protein networkhttps://string-db.org/network/866895.HBHAL_1838TetR family transcription regulator.
yoqW protein networkhttps://string-db.org/network/866895.HBHAL_1839Hypothetical protein; Belongs to the SOS response-associated peptidase family.
CCG44204.1 protein networkhttps://string-db.org/network/866895.HBHAL_1840Diguanylate cyclase domain protein / diguanylate phosphodiesterase domain protein.
CCG44206.1 protein networkhttps://string-db.org/network/866895.HBHAL_1842Conserved hypothetical protein.
CCG44207.1 protein networkhttps://string-db.org/network/866895.HBHAL_1843Amino acid transporter.
CCG44208.1 protein networkhttps://string-db.org/network/866895.HBHAL_1844Protein-tyrosine-phosphatase; Belongs to the low molecular weight phosphotyrosine protein phosphatase family.
CCG44209.1 protein networkhttps://string-db.org/network/866895.HBHAL_1845Hypothetical protein.
yihY1 protein networkhttps://string-db.org/network/866895.HBHAL_1846YihY family protein; Belongs to the UPF0761 family.
CCG44211.1 protein networkhttps://string-db.org/network/866895.HBHAL_1847Heavy metal-transporting P-type ATPase.
CCG44212.1 protein networkhttps://string-db.org/network/866895.HBHAL_1848ABC-type transport system extracellular binding protein (probable substrate amino acid); Belongs to the bacterial solute-binding protein 3 family.
CCG44213.1 protein networkhttps://string-db.org/network/866895.HBHAL_1849ABC-type transport system permease protein (probable substrate amino acid).
CCG44214.1 protein networkhttps://string-db.org/network/866895.HBHAL_1850ABC-type transport system ATP-binding protein (probable substrate zinc).
CCG44215.1 protein networkhttps://string-db.org/network/866895.HBHAL_1851ABC-type transport system permease protein (probable substrate zinc).
zur protein networkhttps://string-db.org/network/866895.HBHAL_1852Fur family transcription regulator; Belongs to the Fur family.
CCG44217.1 protein networkhttps://string-db.org/network/866895.HBHAL_1853ABC-type transport system extracellular binding protein (probable substrate zinc); Belongs to the bacterial solute-binding protein 9 family.
yfkF protein networkhttps://string-db.org/network/866895.HBHAL_1854MFS-type transporter.
CCG44219.1 protein networkhttps://string-db.org/network/866895.HBHAL_1855Hypothetical protein.
yyaS2 protein networkhttps://string-db.org/network/866895.HBHAL_1856Conserved hypothetical protein.
yfkD protein networkhttps://string-db.org/network/866895.HBHAL_1857Conserved hypothetical protein.
CCG44222.1 protein networkhttps://string-db.org/network/866895.HBHAL_1858Probable small-conductance mechanosensitive channel.
CCG44223.1 protein networkhttps://string-db.org/network/866895.HBHAL_1859ABC-type transport system ATP-binding protein.
CCG44224.1 protein networkhttps://string-db.org/network/866895.HBHAL_1860Probable ABC-type transport system permease protein.
CCG44225.1 protein networkhttps://string-db.org/network/866895.HBHAL_1861Two-component response regulator.
CCG44226.1 protein networkhttps://string-db.org/network/866895.HBHAL_1862Two-component sensor histidine kinase.
CCG44227.1 protein networkhttps://string-db.org/network/866895.HBHAL_1863Hypothetical protein.
CCG44228.1 protein networkhttps://string-db.org/network/866895.HBHAL_1864Hypothetical protein.
CCG44229.1 protein networkhttps://string-db.org/network/866895.HBHAL_1865Na+/H+ antiporter family protein.
CCG44230.1 protein networkhttps://string-db.org/network/866895.HBHAL_1867Putative polysaccharide deacetylase.
yfjP protein networkhttps://string-db.org/network/866895.HBHAL_1868DNA-3-methyladenine glycosylase YfjP.
CCG44232.1 protein networkhttps://string-db.org/network/866895.HBHAL_1869Two-component sensor histidine kinase.
CCG44234.1 protein networkhttps://string-db.org/network/866895.HBHAL_1872Hypothetical protein.
CCG44235.1 protein networkhttps://string-db.org/network/866895.HBHAL_1873acetate--CoA ligase.
CCG44236.1 protein networkhttps://string-db.org/network/866895.HBHAL_1874Acetyltransferase, GNAT family.
CCG44237.1 protein networkhttps://string-db.org/network/866895.HBHAL_1875Conserved hypothetical protein.
CCG44238.1 protein networkhttps://string-db.org/network/866895.HBHAL_1876Hypothetical protein.
CCG44241.1 protein networkhttps://string-db.org/network/866895.HBHAL_1879Hypothetical protein.
CCG44242.1 protein networkhttps://string-db.org/network/866895.HBHAL_1880BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family.
CCG44243.1 protein networkhttps://string-db.org/network/866895.HBHAL_1881Hypothetical protein.
CCG44244.1 protein networkhttps://string-db.org/network/866895.HBHAL_1882Conserved hypothetical protein.
CCG44245.1 protein networkhttps://string-db.org/network/866895.HBHAL_1883Bacterial luciferase family protein.
CCG44246.1 protein networkhttps://string-db.org/network/866895.HBHAL_1884Hypothetical protein.
CCG44247.1 protein networkhttps://string-db.org/network/866895.HBHAL_1885PTS system subunit IIBC, mannitol-specific.
CCG44248.1 protein networkhttps://string-db.org/network/866895.HBHAL_1886MtlR/BglG family transcription regulator.
CCG44249.1 protein networkhttps://string-db.org/network/866895.HBHAL_1887PTS system subunit IIA, mannitol-specific.
mtlD protein networkhttps://string-db.org/network/866895.HBHAL_1888Mannitol-1-phosphate 5-dehydrogenase.
CCG44251.1 protein networkhttps://string-db.org/network/866895.HBHAL_1889Hypothetical protein.
yusX protein networkhttps://string-db.org/network/866895.HBHAL_1890M3 family peptidase.
dcoH protein networkhttps://string-db.org/network/866895.HBHAL_1891Pterin-4-alpha-carbinolamine dehydratase,putative.
CCG44254.1 protein networkhttps://string-db.org/network/866895.HBHAL_1892Conserved hypothetical protein.
rluD1 protein networkhttps://string-db.org/network/866895.HBHAL_1893Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family.
CCG44256.1 protein networkhttps://string-db.org/network/866895.HBHAL_1894GTP-binding protein TypA/BipA.
CCG44257.1 protein networkhttps://string-db.org/network/866895.HBHAL_1895Hypothetical protein.
CCG44258.1 protein networkhttps://string-db.org/network/866895.HBHAL_1896Hypothetical protein.
yyaS5 protein networkhttps://string-db.org/network/866895.HBHAL_1897Conserved hypothetical protein.
CCG44260.1 protein networkhttps://string-db.org/network/866895.HBHAL_1898MFS-type transporter (probable function bicyclomycin/chloramphenicol resistance).
CCG44261.1 protein networkhttps://string-db.org/network/866895.HBHAL_1899IS1341-type transposase.
CCG44262.1 protein networkhttps://string-db.org/network/866895.HBHAL_1900Conserved hypothetical protein.
CCG44263.1 protein networkhttps://string-db.org/network/866895.HBHAL_1901acyl-CoA dehydrogenase.
CCG44264.1 protein networkhttps://string-db.org/network/866895.HBHAL_1902CAIB/BAIF family protein; Belongs to the CoA-transferase III family.
CCG44265.1 protein networkhttps://string-db.org/network/866895.HBHAL_1903Aminotransferase.
ilvB2 protein networkhttps://string-db.org/network/866895.HBHAL_1904Acetolactate synthase large subunit; Belongs to the TPP enzyme family.
CCG44267.1 protein networkhttps://string-db.org/network/866895.HBHAL_1905Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
CCG44268.1 protein networkhttps://string-db.org/network/866895.HBHAL_1906Saccharopine dehydrogenase.
CCG44269.1 protein networkhttps://string-db.org/network/866895.HBHAL_1907Hypothetical protein.
CCG44270.1 protein networkhttps://string-db.org/network/866895.HBHAL_19084-aminobutyrate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
ykoY1 protein networkhttps://string-db.org/network/866895.HBHAL_1909TerC family protein.
CCG44272.1 protein networkhttps://string-db.org/network/866895.HBHAL_1910Putative sporulation control protein.
CCG44273.1 protein networkhttps://string-db.org/network/866895.HBHAL_1911Hypothetical protein.
CCG44274.1 protein networkhttps://string-db.org/network/866895.HBHAL_1912Short-chain dehydrogenase/reductase family protein.
CCG44275.1 protein networkhttps://string-db.org/network/866895.HBHAL_1913Acyltransferase 3.
nadE1 protein networkhttps://string-db.org/network/866895.HBHAL_1914NH3-dependent NAD+ synthetase; Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses ammonia as a nitrogen source; Belongs to the NAD synthetase family.
yaaI protein networkhttps://string-db.org/network/866895.HBHAL_1915Isochorismatase family protein.
mutS3 protein networkhttps://string-db.org/network/866895.HBHAL_1916DNA mismatch repair protein MutS; Endonuclease that is involved in the suppression of homologous recombination and may therefore have a key role in the control of bacterial genetic diversity. Bel [...]
msrA-2 protein networkhttps://string-db.org/network/866895.HBHAL_1917methionine-R-sulfoxide reductase; Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methionine sul [...]
CCG44280.1 protein networkhttps://string-db.org/network/866895.HBHAL_1918Hypothetical protein.
CCG44281.1 protein networkhttps://string-db.org/network/866895.HBHAL_1919Conserved hypothetical protein.
CCG44282.1 protein networkhttps://string-db.org/network/866895.HBHAL_1920NADH:flavin oxidoreductase / NADH oxidase family protein.
pcrA2 protein networkhttps://string-db.org/network/866895.HBHAL_1921ATP-dependent DNA helicase PcrA.
CCG44284.1 protein networkhttps://string-db.org/network/866895.HBHAL_1922Probable small-conductance mechanosensitive channel.
CCG44285.1 protein networkhttps://string-db.org/network/866895.HBHAL_1924Hypothetical protein.
CCG44286.1 protein networkhttps://string-db.org/network/866895.HBHAL_1925Acetyltransferase, GNAT family.
CCG44287.1 protein networkhttps://string-db.org/network/866895.HBHAL_1926Conserved hypothetical protein.
CCG44288.1 protein networkhttps://string-db.org/network/866895.HBHAL_1927Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG44289.1 protein networkhttps://string-db.org/network/866895.HBHAL_1928Probable ABC-type transport system permease protein.
CCG44290.1 protein networkhttps://string-db.org/network/866895.HBHAL_1929ABC-type transport system ATP-binding protein.
CCG44291.1 protein networkhttps://string-db.org/network/866895.HBHAL_1930Hypothetical protein.
CCG44292.1 protein networkhttps://string-db.org/network/866895.HBHAL_1931Hypothetical protein; Belongs to the UPF0145 family.
CCG44293.1 protein networkhttps://string-db.org/network/866895.HBHAL_1932Hypothetical protein.
CCG44294.1 protein networkhttps://string-db.org/network/866895.HBHAL_1933Hypothetical protein.
CCG44295.1 protein networkhttps://string-db.org/network/866895.HBHAL_1934Hypothetical protein.
sigY protein networkhttps://string-db.org/network/866895.HBHAL_1935RNA polymerase sigma factor SigY; Belongs to the sigma-70 factor family. ECF subfamily.
trpE protein networkhttps://string-db.org/network/866895.HBHAL_1936Anthranilate synthase component I; Part of a heterotetrameric complex that catalyzes the two- step biosynthesis of anthranilate, an intermediate in the biosynthesis of L-tryptophan. In the first [...]
trpD protein networkhttps://string-db.org/network/866895.HBHAL_1937Anthranilate phosphoribosyltransferase; Catalyzes the transfer of the phosphoribosyl group of 5- phosphorylribose-1-pyrophosphate (PRPP) to anthranilate to yield N-(5'- phosphoribosyl)-anthranila [...]
trpC protein networkhttps://string-db.org/network/866895.HBHAL_1938Indole-3-glycerol-phosphate synthase; Belongs to the TrpC family.
trpF protein networkhttps://string-db.org/network/866895.HBHAL_1939N-(5'-phosphoribosyl)anthranilate isomerase; Belongs to the TrpF family.
trpB protein networkhttps://string-db.org/network/866895.HBHAL_1940Tryptophan synthase beta subunit; The beta subunit is responsible for the synthesis of L- tryptophan from indole and L-serine.
trpA protein networkhttps://string-db.org/network/866895.HBHAL_1941Tryptophan synthase alpha subunit; The alpha subunit is responsible for the aldol cleavage of indoleglycerol phosphate to indole and glyceraldehyde 3-phosphate. Belongs to the TrpA family.
trpG1 protein networkhttps://string-db.org/network/866895.HBHAL_1942Anthranilate synthase component II.
CCG44304.1 protein networkhttps://string-db.org/network/866895.HBHAL_1943SSS family transporter (probable function sodium:proline symport); Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
CCG44305.1 protein networkhttps://string-db.org/network/866895.HBHAL_1944Two-component response regulator.
CCG44306.1 protein networkhttps://string-db.org/network/866895.HBHAL_1945Hypothetical protein.
sipW protein networkhttps://string-db.org/network/866895.HBHAL_1946Signal peptidase I.
CCG44308.1 protein networkhttps://string-db.org/network/866895.HBHAL_1947Camelysin.
npr1 protein networkhttps://string-db.org/network/866895.HBHAL_1948Neutral protease; Extracellular zinc metalloprotease.
CCG44310.1 protein networkhttps://string-db.org/network/866895.HBHAL_1949Manganese catalase.
xynB protein networkhttps://string-db.org/network/866895.HBHAL_1950Xylan 1,4-beta-xylosidase; Belongs to the glycosyl hydrolase 43 family.
CCG44312.1 protein networkhttps://string-db.org/network/866895.HBHAL_1951ROK family protein.
CCG44313.1 protein networkhttps://string-db.org/network/866895.HBHAL_1952ABC-type transport system extracellular binding protein (probable substrate sugar).
CCG44314.1 protein networkhttps://string-db.org/network/866895.HBHAL_1953ABC-type transport system permease protein (probable substrate sugar).
CCG44315.1 protein networkhttps://string-db.org/network/866895.HBHAL_1954ABC-type transport system permease protein (probable substrate sugar).
CCG44316.1 protein networkhttps://string-db.org/network/866895.HBHAL_1955Conserved hypothetical protein.
xylA protein networkhttps://string-db.org/network/866895.HBHAL_1956Xylose isomerase; Belongs to the xylose isomerase family.
xylB protein networkhttps://string-db.org/network/866895.HBHAL_1957Xylulose kinase.
CCG44319.1 protein networkhttps://string-db.org/network/866895.HBHAL_1958Oxidoreductase, aldo/keto reductase family.
mro protein networkhttps://string-db.org/network/866895.HBHAL_1959Aldose 1-epimerase; Converts alpha-aldose to the beta-anomer.
CCG44321.1 protein networkhttps://string-db.org/network/866895.HBHAL_1960Hypothetical protein.
CCG44322.1 protein networkhttps://string-db.org/network/866895.HBHAL_1961Hypothetical protein.
CCG44323.1 protein networkhttps://string-db.org/network/866895.HBHAL_1962Capsular polysaccharide biosynthesis protein.
CCG44324.1 protein networkhttps://string-db.org/network/866895.HBHAL_1963Capsular polysaccharide biosynthesis protein,putative tyrosine-protein kinase.
CCG44325.1 protein networkhttps://string-db.org/network/866895.HBHAL_1964Capsular polysaccharide biosynthesis protein.
epsD protein networkhttps://string-db.org/network/866895.HBHAL_1965Probable glycosyltransferase EpsD.
CCG44327.1 protein networkhttps://string-db.org/network/866895.HBHAL_1966Group 1 glycosyltransferase.
CCG44328.1 protein networkhttps://string-db.org/network/866895.HBHAL_1967Group 2 glycosyltransferase.
yveQ protein networkhttps://string-db.org/network/866895.HBHAL_1968Hypothetical protein.
galE1 protein networkhttps://string-db.org/network/866895.HBHAL_1969UDP-glucose 4-epimerase; Belongs to the NAD(P)-dependent epimerase/dehydratase family.
CCG44331.1 protein networkhttps://string-db.org/network/866895.HBHAL_1970Undecaprenyl-phosphate galactose phosphotransferase.
epsM protein networkhttps://string-db.org/network/866895.HBHAL_1971Probable acetyltransferase EpsM.
CCG44333.1 protein networkhttps://string-db.org/network/866895.HBHAL_1972Putative aminotransferase; Belongs to the DegT/DnrJ/EryC1 family.
sinR protein networkhttps://string-db.org/network/866895.HBHAL_1973Transcription regulator SinR.
CCG44335.1 protein networkhttps://string-db.org/network/866895.HBHAL_1974Group 1 glycosyltransferase.
CCG44336.1 protein networkhttps://string-db.org/network/866895.HBHAL_1975Capsular polysaccharide biosynthesis protein.
wcmJ protein networkhttps://string-db.org/network/866895.HBHAL_1976Hypothetical protein.
CCG44338.1 protein networkhttps://string-db.org/network/866895.HBHAL_1977Hypothetical protein.
CCG44339.1 protein networkhttps://string-db.org/network/866895.HBHAL_1978Polysaccharide biosynthesis protein.
prk protein networkhttps://string-db.org/network/866895.HBHAL_1979Phosphoribulokinase.
CCG44341.1 protein networkhttps://string-db.org/network/866895.HBHAL_1980HAD superfamily hydrolase.
CCG44342.1 protein networkhttps://string-db.org/network/866895.HBHAL_1981Class II aldolase/adducin family protein.
CCG44343.1 protein networkhttps://string-db.org/network/866895.HBHAL_1982Conserved hypothetical protein.
CCG44344.1 protein networkhttps://string-db.org/network/866895.HBHAL_1983Group 2 glycosyltransferase.
CCG44345.1 protein networkhttps://string-db.org/network/866895.HBHAL_1984Conserved hypothetical protein.
CCG44346.1 protein networkhttps://string-db.org/network/866895.HBHAL_1985Hypothetical protein.
yclG protein networkhttps://string-db.org/network/866895.HBHAL_1986Hypothetical protein.
HBHAL_1988 protein networkhttps://string-db.org/network/866895.HBHAL_1988ABC-type transport system ATP-binding protein (nonfunctional).
CCG44350.1 protein networkhttps://string-db.org/network/866895.HBHAL_1989Hypothetical protein.
CCG44351.1 protein networkhttps://string-db.org/network/866895.HBHAL_1990Hypothetical protein.
CCG44352.1 protein networkhttps://string-db.org/network/866895.HBHAL_1991ABC-type transport system ATP-binding/permease protein.
CCG44353.1 protein networkhttps://string-db.org/network/866895.HBHAL_1992Hypothetical protein.
CCG44354.1 protein networkhttps://string-db.org/network/866895.HBHAL_1993Conserved hypothetical protein.
CCG44355.1 protein networkhttps://string-db.org/network/866895.HBHAL_1994Conserved hypothetical protein.
CCG44356.1 protein networkhttps://string-db.org/network/866895.HBHAL_1995Probable RNA-directed DNA polymerase.
CCG44357.1 protein networkhttps://string-db.org/network/866895.HBHAL_1996Short-chain dehydrogenase/reductase family protein.
CCG44358.1 protein networkhttps://string-db.org/network/866895.HBHAL_1997Hypothetical protein.
CCG44359.1 protein networkhttps://string-db.org/network/866895.HBHAL_1998Hypothetical protein.
CCG44360.1 protein networkhttps://string-db.org/network/866895.HBHAL_1999Hypothetical protein.
alkK protein networkhttps://string-db.org/network/866895.HBHAL_2000AMP-binding enzyme.
CCG44362.1 protein networkhttps://string-db.org/network/866895.HBHAL_2001Hypothetical protein.
CCG44363.1 protein networkhttps://string-db.org/network/866895.HBHAL_2002Putative beta-ketoadipate enol-lactone hydrolase.
CCG44364.1 protein networkhttps://string-db.org/network/866895.HBHAL_2003Hypothetical protein.
CCG44365.1 protein networkhttps://string-db.org/network/866895.HBHAL_2004Putative bile acid/sodium symporter (BASS) family protein.
CCG44366.1 protein networkhttps://string-db.org/network/866895.HBHAL_2005Hypothetical protein.
CCG44367.1 protein networkhttps://string-db.org/network/866895.HBHAL_2006Hypothetical protein.
CCG44368.1 protein networkhttps://string-db.org/network/866895.HBHAL_2007Hypothetical protein.
queE protein networkhttps://string-db.org/network/866895.HBHAL_20087-carboxy-7-deazaguanine synthase; Catalyzes the complex heterocyclic radical-mediated conversion of 6-carboxy-5,6,7,8-tetrahydropterin (CPH4) to 7-carboxy-7- deazaguanine (CDG), a step common to [...]
ygcM protein networkhttps://string-db.org/network/866895.HBHAL_20096-pyruvoyl tetrahydrobiopterin synthase.
queC protein networkhttps://string-db.org/network/866895.HBHAL_20107-cyano-7-deazaguanine synthase; Catalyzes the ATP-dependent conversion of 7-carboxy-7- deazaguanine (CDG) to 7-cyano-7-deazaguanine (preQ(0)).
CCG44372.1 protein networkhttps://string-db.org/network/866895.HBHAL_2011L-lactate permease family transporter; Transports L-lactate across the membrane. Can also transport D-lactate and glycolate; Belongs to the lactate permease family.
argG protein networkhttps://string-db.org/network/866895.HBHAL_2012Argininosuccinate synthase; Belongs to the argininosuccinate synthase family. Type 1 subfamily.
argH protein networkhttps://string-db.org/network/866895.HBHAL_2013Argininosuccinate lyase.
CCG44375.1 protein networkhttps://string-db.org/network/866895.HBHAL_2014Hypothetical protein.
CCG44376.1 protein networkhttps://string-db.org/network/866895.HBHAL_2015Hypothetical protein.
CCG44377.1 protein networkhttps://string-db.org/network/866895.HBHAL_2016Hypothetical protein.
yqgT protein networkhttps://string-db.org/network/866895.HBHAL_2017gamma-D-glutamyl-L-diamino acid endopeptidase.
CCG44379.1 protein networkhttps://string-db.org/network/866895.HBHAL_2018Peroxiredoxin; Thiol-specific peroxidase that catalyzes the reduction of hydrogen peroxide and organic hydroperoxides to water and alcohols, respectively. Plays a role in cell protection against [...]
deaD protein networkhttps://string-db.org/network/866895.HBHAL_2019ATP-dependent RNA helicase.
yrrT protein networkhttps://string-db.org/network/866895.HBHAL_2020S-adenosylmethionine-dependent methyltransferase YrrT; Could be a S-adenosyl-L-methionine-dependent methyltransferase.
luxS protein networkhttps://string-db.org/network/866895.HBHAL_2021S-ribosylhomocysteine lyase; Involved in the synthesis of autoinducer 2 (AI-2) which is secreted by bacteria and is used to communicate both the cell density and the metabolic potential of the en [...]
mccA protein networkhttps://string-db.org/network/866895.HBHAL_2022O-acetylserine dependent cystathionine beta-synthase.
mccB protein networkhttps://string-db.org/network/866895.HBHAL_2023Cystathionine gamma-lyase / homocysteine gamma-lyase.
yteA protein networkhttps://string-db.org/network/866895.HBHAL_2024YteA family regulatory protein.
CCG44386.1 protein networkhttps://string-db.org/network/866895.HBHAL_2025Conserved hypothetical protein.
CCG44387.1 protein networkhttps://string-db.org/network/866895.HBHAL_2026ABC-type transport system ATP-binding protein (probable substrate sulfonate/nitrate/taurine).
CCG44388.1 protein networkhttps://string-db.org/network/866895.HBHAL_2027ABC-type transport system permease protein (probable substrate sulfonate/nitrate/taurine).
CCG44389.1 protein networkhttps://string-db.org/network/866895.HBHAL_2028ABC-type transport system extracellular binding protein (probable substrate sulfonate/nitrate/taurine).
CCG44390.1 protein networkhttps://string-db.org/network/866895.HBHAL_2029YqiR family transcription regulator.
CCG44391.1 protein networkhttps://string-db.org/network/866895.HBHAL_20303-oxoacid CoA-transferase.
CCG44392.1 protein networkhttps://string-db.org/network/866895.HBHAL_20313-oxoacid CoA-transferase.
CCG44393.1 protein networkhttps://string-db.org/network/866895.HBHAL_2032Short-chain dehydrogenase/reductase family protein.
CCG44394.1 protein networkhttps://string-db.org/network/866895.HBHAL_2033acetyl-CoA acyltransferase; Belongs to the thiolase-like superfamily. Thiolase family.
CCG44395.1 protein networkhttps://string-db.org/network/866895.HBHAL_2034CCS family transporter (probable substrate citrate).
CCG44396.1 protein networkhttps://string-db.org/network/866895.HBHAL_2035Acetyltransferase, GNAT family.
CCG44397.1 protein networkhttps://string-db.org/network/866895.HBHAL_2036Hypothetical protein.
CCG44398.1 protein networkhttps://string-db.org/network/866895.HBHAL_2037Conserved hypothetical protein.
CCG44399.1 protein networkhttps://string-db.org/network/866895.HBHAL_2038Peptidase C60 sortase A and B.
CCG44400.1 protein networkhttps://string-db.org/network/866895.HBHAL_2039Hypothetical protein.
hutI protein networkhttps://string-db.org/network/866895.HBHAL_2040Putative imidazolonepropionase.
yfhF protein networkhttps://string-db.org/network/866895.HBHAL_2041Epimerase family protein YfhF.
recX protein networkhttps://string-db.org/network/866895.HBHAL_2042Recombination regulator RecX; Modulates RecA activity; Belongs to the RecX family.
CCG44404.1 protein networkhttps://string-db.org/network/866895.HBHAL_2043IS1341-type transposase.
CCG44405.1 protein networkhttps://string-db.org/network/866895.HBHAL_2044NUDIX family hydrolase; Belongs to the Nudix hydrolase family.
CCG44406.1 protein networkhttps://string-db.org/network/866895.HBHAL_2045HAD superfamily hydrolase.
CCG44407.1 protein networkhttps://string-db.org/network/866895.HBHAL_2046GlcT family transcription regulator.
CCG44408.1 protein networkhttps://string-db.org/network/866895.HBHAL_2047PTS system subunit IIBC, glucose-specific.
CCG44409.1 protein networkhttps://string-db.org/network/866895.HBHAL_2048Phosphocarrier protein HPr.
CCG44410.1 protein networkhttps://string-db.org/network/866895.HBHAL_2049Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
yfhH protein networkhttps://string-db.org/network/866895.HBHAL_2050Hypothetical protein.
yfhJ protein networkhttps://string-db.org/network/866895.HBHAL_2051Hypothetical protein.
yfhP protein networkhttps://string-db.org/network/866895.HBHAL_2052Conserved hypothetical protein.
yfhQ protein networkhttps://string-db.org/network/866895.HBHAL_2053A/G-specific adenine glycosylase; Adenine glycosylase active on G-A mispairs.
CCG44415.1 protein networkhttps://string-db.org/network/866895.HBHAL_2054Hypothetical protein.
lytE1 protein networkhttps://string-db.org/network/866895.HBHAL_2055Cell wall hydrolase LytE.
sspE protein networkhttps://string-db.org/network/866895.HBHAL_2056Gamma-type small, acid-soluble spore protein.
CCG44418.1 protein networkhttps://string-db.org/network/866895.HBHAL_2057Hypothetical protein.
CCG44419.1 protein networkhttps://string-db.org/network/866895.HBHAL_2058Conserved hypothetical protein; Belongs to the UPF0374 family.
CCG44420.1 protein networkhttps://string-db.org/network/866895.HBHAL_2059ABC-type transport system ATP-binding/permease protein.
CCG44421.1 protein networkhttps://string-db.org/network/866895.HBHAL_2060Hypothetical protein.
CCG44422.1 protein networkhttps://string-db.org/network/866895.HBHAL_2061Conserved hypothetical protein.
CCG44423.1 protein networkhttps://string-db.org/network/866895.HBHAL_2062Hypothetical protein.
hemL-2 protein networkhttps://string-db.org/network/866895.HBHAL_2063Glutamate-1-semialdehyde aminotransferase.
CCG44425.1 protein networkhttps://string-db.org/network/866895.HBHAL_2064Conserved hypothetical protein.
ygaF protein networkhttps://string-db.org/network/866895.HBHAL_2065Probable peroxiredoxin YgaF.
CCG44427.1 protein networkhttps://string-db.org/network/866895.HBHAL_2066Probable 2-hydroxyacid dehydrogenase (NAD); Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
pduO protein networkhttps://string-db.org/network/866895.HBHAL_2067cob(I)yrinic acid a,c-diamide adenosyltransferase; Belongs to the Cob(I)alamin adenosyltransferase family.
perR protein networkhttps://string-db.org/network/866895.HBHAL_2068Fur family transcription regulator; Belongs to the Fur family.
CCG44430.1 protein networkhttps://string-db.org/network/866895.HBHAL_2069Hypothetical protein.
ygxA protein networkhttps://string-db.org/network/866895.HBHAL_2070Hypothetical protein.
CCG44432.1 protein networkhttps://string-db.org/network/866895.HBHAL_2074Hypothetical protein.
CCG44433.1 protein networkhttps://string-db.org/network/866895.HBHAL_2075Hypothetical protein.
ade2 protein networkhttps://string-db.org/network/866895.HBHAL_2076Adenine deaminase; Belongs to the metallo-dependent hydrolases superfamily. Adenine deaminase family.
traB protein networkhttps://string-db.org/network/866895.HBHAL_2077TraB family protein.
CCG44436.1 protein networkhttps://string-db.org/network/866895.HBHAL_2078Hypothetical protein.
CCG44437.1 protein networkhttps://string-db.org/network/866895.HBHAL_2079DUF6 family protein.
CCG44438.1 protein networkhttps://string-db.org/network/866895.HBHAL_2080Hypothetical protein.
CCG44440.1 protein networkhttps://string-db.org/network/866895.HBHAL_2082Hypothetical protein.
queG protein networkhttps://string-db.org/network/866895.HBHAL_2083Hypothetical protein; Catalyzes the conversion of epoxyqueuosine (oQ) to queuosine (Q), which is a hypermodified base found in the wobble positions of tRNA(Asp), tRNA(Asn), tRNA(His) and tRNA(Tyr [...]
CCG44442.1 protein networkhttps://string-db.org/network/866895.HBHAL_2084methylated-DNA--protein- cysteinemethyltransferase; Involved in the cellular defense against the biological effects of O6-methylguanine (O6-MeG) and O4-methylthymine (O4-MeT) in DNA. Repairs the [...]
yhbB protein networkhttps://string-db.org/network/866895.HBHAL_2085Hypothetical protein.
CCG44444.1 protein networkhttps://string-db.org/network/866895.HBHAL_2086RNA methyltransferase; Could methylate the ribose at the nucleotide 34 wobble position in tRNA; Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH [...]
CCG44445.1 protein networkhttps://string-db.org/network/866895.HBHAL_2087IS150-type transposase orfAB.
lipA protein networkhttps://string-db.org/network/866895.HBHAL_2091Lipoyl synthase; Catalyzes the radical-mediated insertion of two sulfur atoms into the C-6 and C-8 positions of the octanoyl moiety bound to the lipoyl domains of lipoate-dependent enzymes, there [...]
lipM protein networkhttps://string-db.org/network/866895.HBHAL_2092Octanoyltransferase LipM.
prkA protein networkhttps://string-db.org/network/866895.HBHAL_2093Serine/threonine-protein kinase PrkA.
ppx protein networkhttps://string-db.org/network/866895.HBHAL_2094Ppx/GppA phosphatase family protein.
ppk protein networkhttps://string-db.org/network/866895.HBHAL_2095Polyphosphate kinase; Catalyzes the reversible transfer of the terminal phosphate of ATP to form a long-chain polyphosphate (polyP). Belongs to the polyphosphate kinase 1 (PPK1) family.
kgd protein networkhttps://string-db.org/network/866895.HBHAL_20962-oxoglutarate dehydrogenase; E1 component of the 2-oxoglutarate dehydrogenase (OGDH) complex which catalyzes the decarboxylation of 2-oxoglutarate, the first step in the conversion of 2-oxogluta [...]
odhB protein networkhttps://string-db.org/network/866895.HBHAL_20972-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase); E2 component of the 2-oxoglutarate dehydrogenase (OGDH) complex which catalyzes the second step in the conversion [...]
CCG44454.1 protein networkhttps://string-db.org/network/866895.HBHAL_2098Hypothetical protein.
yidC protein networkhttps://string-db.org/network/866895.HBHAL_2099Membrane protein insertase YidC; Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane pro [...]
CCG44456.1 protein networkhttps://string-db.org/network/866895.HBHAL_2100UPF0229 family protein; Belongs to the UPF0229 family.
helD protein networkhttps://string-db.org/network/866895.HBHAL_2101Helicase IV.
CCG44458.1 protein networkhttps://string-db.org/network/866895.HBHAL_2102Na+/H+ antiporter family protein.
proC protein networkhttps://string-db.org/network/866895.HBHAL_2103Pyrroline-5-carboxylate reductase; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline.
ydbS protein networkhttps://string-db.org/network/866895.HBHAL_2104UPF0699 family protein YdbS.
ydbT protein networkhttps://string-db.org/network/866895.HBHAL_2105UPF0699 family protein YdbT.
CCG44462.1 protein networkhttps://string-db.org/network/866895.HBHAL_2106MFS-type transporter (probable substrate xanthine/uracil).
CCG44463.1 protein networkhttps://string-db.org/network/866895.HBHAL_2107Spore germination protein.
CCG44464.1 protein networkhttps://string-db.org/network/866895.HBHAL_2108Spore germination protein.
CCG44465.1 protein networkhttps://string-db.org/network/866895.HBHAL_2109Spore germination protein.
CCG44466.1 protein networkhttps://string-db.org/network/866895.HBHAL_2110Conserved hypothetical protein.
CCG44467.1 protein networkhttps://string-db.org/network/866895.HBHAL_2111CNT family transporter.
CCG44468.1 protein networkhttps://string-db.org/network/866895.HBHAL_2112Aldehyde dehydrogenase.
norM protein networkhttps://string-db.org/network/866895.HBHAL_2114MATE efflux family protein.
murG protein networkhttps://string-db.org/network/866895.HBHAL_2116Undecaprenyl-PP-MurNAc-pentapeptide-UDPGlcNAc GlcNAc transferase; Cell wall formation. Catalyzes the transfer of a GlcNAc subunit on undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide (lipid interme [...]
CCG44472.1 protein networkhttps://string-db.org/network/866895.HBHAL_2117Putative anti-sigma regulatory factor,serine/threonine protein kinase.
CCG44473.1 protein networkhttps://string-db.org/network/866895.HBHAL_2118Hypothetical protein.
CCG44474.1 protein networkhttps://string-db.org/network/866895.HBHAL_2119UvrD/REP helicase family protein.
CCG44475.1 protein networkhttps://string-db.org/network/866895.HBHAL_21202,5-didehydrogluconate reductase.
CCG44476.1 protein networkhttps://string-db.org/network/866895.HBHAL_2121Spore germination protein.
CCG44477.1 protein networkhttps://string-db.org/network/866895.HBHAL_2122Spore germination protein.
CCG44478.1 protein networkhttps://string-db.org/network/866895.HBHAL_2123Spore germination protein.
CCG44479.1 protein networkhttps://string-db.org/network/866895.HBHAL_2124Conserved hypothetical protein.
CCG44480.1 protein networkhttps://string-db.org/network/866895.HBHAL_2125ABC-type transport system ATP-binding/permease protein.
CCG44481.1 protein networkhttps://string-db.org/network/866895.HBHAL_2126ABC-type transport system ATP-binding/permease protein.
mucD protein networkhttps://string-db.org/network/866895.HBHAL_2127S7 family peptidase.
CCG44483.1 protein networkhttps://string-db.org/network/866895.HBHAL_2128Hypothetical protein.
sigI protein networkhttps://string-db.org/network/866895.HBHAL_2129RNA polymerase sigma factor SigI; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released; Belongs to the sigma-70 fa [...]
ykrI protein networkhttps://string-db.org/network/866895.HBHAL_2130Hypothetical protein.
CCG44486.1 protein networkhttps://string-db.org/network/866895.HBHAL_2131Conserved hypothetical protein.
CCG44487.1 protein networkhttps://string-db.org/network/866895.HBHAL_2132FAD-dependent oxidoreductase.
yhcX protein networkhttps://string-db.org/network/866895.HBHAL_2134Probable carbon-nitrogen hydrolase.
CCG44490.1 protein networkhttps://string-db.org/network/866895.HBHAL_2135Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
yhdB protein networkhttps://string-db.org/network/866895.HBHAL_2136Hypothetical protein.
CCG44492.1 protein networkhttps://string-db.org/network/866895.HBHAL_2137Hypothetical protein.
CCG44493.1 protein networkhttps://string-db.org/network/866895.HBHAL_2138Conserved hypothetical protein.
CCG44494.1 protein networkhttps://string-db.org/network/866895.HBHAL_2139Acetyltransferase, GNAT family.
CCG44495.1 protein networkhttps://string-db.org/network/866895.HBHAL_2140Hypothetical protein.
CCG44496.1 protein networkhttps://string-db.org/network/866895.HBHAL_2141Stage V sporulation protein R.
CCG44497.1 protein networkhttps://string-db.org/network/866895.HBHAL_2142Hypothetical protein.
pyrH2 protein networkhttps://string-db.org/network/866895.HBHAL_2143Uridylate kinase; Catalyzes the reversible phosphorylation of UMP to UDP.
CCG44499.1 protein networkhttps://string-db.org/network/866895.HBHAL_2144D-amino-acid aminotransferase.
CCG44500.1 protein networkhttps://string-db.org/network/866895.HBHAL_2145Conserved hypothetical protein.
yyaS3 protein networkhttps://string-db.org/network/866895.HBHAL_2146Conserved hypothetical protein.
CCG44502.1 protein networkhttps://string-db.org/network/866895.HBHAL_2147Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG44503.1 protein networkhttps://string-db.org/network/866895.HBHAL_2148Hypothetical protein.
CCG44504.1 protein networkhttps://string-db.org/network/866895.HBHAL_2149Conserved hypothetical protein.
CCG44507.1 protein networkhttps://string-db.org/network/866895.HBHAL_2153Na+/H+ antiporter family protein.
CCG44508.1 protein networkhttps://string-db.org/network/866895.HBHAL_2154Hypothetical protein.
CCG44510.1 protein networkhttps://string-db.org/network/866895.HBHAL_2156Hypothetical protein.
CCG44511.1 protein networkhttps://string-db.org/network/866895.HBHAL_2157Acetyltransferase, GNAT family.
CCG44512.1 protein networkhttps://string-db.org/network/866895.HBHAL_2158Sulfate transporter familiy protein.
uspA1 protein networkhttps://string-db.org/network/866895.HBHAL_2159UspA domain protein.
CCG44514.1 protein networkhttps://string-db.org/network/866895.HBHAL_2160Conserved hypothetical protein.
CCG44515.1 protein networkhttps://string-db.org/network/866895.HBHAL_2161Probable ABC-type transport system permease protein.
CCG44516.1 protein networkhttps://string-db.org/network/866895.HBHAL_2162ABC-type transport system ATP-binding protein.
CCG44517.1 protein networkhttps://string-db.org/network/866895.HBHAL_2163Acetyltransferase, GNAT family.
CCG44518.1 protein networkhttps://string-db.org/network/866895.HBHAL_2164Maltose O-acetyltransferase.
map2 protein networkhttps://string-db.org/network/866895.HBHAL_2165Methionine aminopeptidase; Removes the N-terminal methionine from nascent proteins. The N-terminal methionine is often cleaved when the second residue in the primary sequence is small and uncharg [...]
cspB protein networkhttps://string-db.org/network/866895.HBHAL_2166Major cold-shock protein.
CCG44521.1 protein networkhttps://string-db.org/network/866895.HBHAL_2167Conserved hypothetical protein.
ycgS protein networkhttps://string-db.org/network/866895.HBHAL_2168Aromatic hydrocarbon catabolism protein.
CCG44523.1 protein networkhttps://string-db.org/network/866895.HBHAL_2169ABC-type transport system extracellular binding protein (probable substrate iron complex).
CCG44524.1 protein networkhttps://string-db.org/network/866895.HBHAL_2170Metallo-beta-lactamase family protein.
CCG44525.1 protein networkhttps://string-db.org/network/866895.HBHAL_2171Na+/H+ antiporter family protein.
azlC protein networkhttps://string-db.org/network/866895.HBHAL_2172AzlC family protein.
CCG44527.1 protein networkhttps://string-db.org/network/866895.HBHAL_2173Hypothetical protein.
CCG44528.1 protein networkhttps://string-db.org/network/866895.HBHAL_2174Conserved hypothetical protein.
CCG44529.1 protein networkhttps://string-db.org/network/866895.HBHAL_2175Acetyltransferase, GNAT family.
CCG44530.1 protein networkhttps://string-db.org/network/866895.HBHAL_2176Cation efflux family protein; Belongs to the cation diffusion facilitator (CDF) transporter (TC 2.A.4) family.
wrbA protein networkhttps://string-db.org/network/866895.HBHAL_2177NADH--quinone oxidoreductase WrbA; Belongs to the WrbA family.
CCG44532.1 protein networkhttps://string-db.org/network/866895.HBHAL_2178Hypothetical protein.
yodJ protein networkhttps://string-db.org/network/866895.HBHAL_2179D-alanyl-D-alanine carboxypeptidase.
CCG44534.1 protein networkhttps://string-db.org/network/866895.HBHAL_2180Conserved hypothetical protein.
CCG44535.1 protein networkhttps://string-db.org/network/866895.HBHAL_2181MFS-type transporter.
CCG44536.1 protein networkhttps://string-db.org/network/866895.HBHAL_2182Conserved hypothetical protein.
fumC protein networkhttps://string-db.org/network/866895.HBHAL_2183Fumarate hydratase; Involved in the TCA cycle. Catalyzes the stereospecific interconversion of fumarate to L-malate; Belongs to the class-II fumarase/aspartase family. Fumarase subfamily.
Sh-1 protein networkhttps://string-db.org/network/866895.HBHAL_2184Small acid-soluble spore protein 1; SASP are bound to spore DNA. They are double-stranded DNA- binding proteins that cause DNA to change to an a-like conformation. They protect the DNA backbone f [...]
CCG44539.1 protein networkhttps://string-db.org/network/866895.HBHAL_2185Hypothetical protein.
CCG44540.1 protein networkhttps://string-db.org/network/866895.HBHAL_2186ABC-type transport system ATP-binding protein; Belongs to the ABC transporter superfamily.
yxkF protein networkhttps://string-db.org/network/866895.HBHAL_2187Hypothetical protein.
CCG44542.1 protein networkhttps://string-db.org/network/866895.HBHAL_2188Conserved hypothetical protein.
CCG44544.1 protein networkhttps://string-db.org/network/866895.HBHAL_2190UPF0754 family protein; Belongs to the UPF0754 family.
yheA protein networkhttps://string-db.org/network/866895.HBHAL_2191Hypothetical protein; Belongs to the UPF0342 family.
CCG44546.1 protein networkhttps://string-db.org/network/866895.HBHAL_2192enoyl-CoA hydratase / 3-hydroxybutyryl-CoA dehydratase.
CCG44547.1 protein networkhttps://string-db.org/network/866895.HBHAL_2193Hypothetical protein.
CCG44548.1 protein networkhttps://string-db.org/network/866895.HBHAL_2194ABC-type transport system ATP-binding protein (probable substrate sodium).
CCG44549.1 protein networkhttps://string-db.org/network/866895.HBHAL_2195ABC-type transport system permease protein (probable substrate sodium).
CCG44550.1 protein networkhttps://string-db.org/network/866895.HBHAL_2196DNA repair exonuclease family protein.
yhaN protein networkhttps://string-db.org/network/866895.HBHAL_2197Hypothetical protein.
CCG44552.1 protein networkhttps://string-db.org/network/866895.HBHAL_2198YuaC family transcription regulator; Belongs to the GbsR family.
yhaM protein networkhttps://string-db.org/network/866895.HBHAL_21993'-5' exoribonuclease YhaM.
CCG44554.1 protein networkhttps://string-db.org/network/866895.HBHAL_2200Hypothetical protein.
CCG44555.1 protein networkhttps://string-db.org/network/866895.HBHAL_2202IS150-type transposase orfAB.
prsA protein networkhttps://string-db.org/network/866895.HBHAL_2203Peptidylprolyl isomerase; Plays a major role in protein secretion by helping the post- translocational extracellular folding of several secreted proteins.
yhaK protein networkhttps://string-db.org/network/866895.HBHAL_2204Hypothetical protein.
hpr protein networkhttps://string-db.org/network/866895.HBHAL_2205MarR family transcription regulator Hpr.
CCG44559.1 protein networkhttps://string-db.org/network/866895.HBHAL_2206YuaC family transcription regulator; Belongs to the GbsR family.
CCG44560.1 protein networkhttps://string-db.org/network/866895.HBHAL_2207ABC-type transport system ATP-binding protein (probable substrate glycine betaine).
CCG44561.1 protein networkhttps://string-db.org/network/866895.HBHAL_2208ABC-type transport system permease protein (probable substrate glycine betaine).
CCG44562.1 protein networkhttps://string-db.org/network/866895.HBHAL_2209ABC-type transport system extracellular binding protein (probable substrate glycine betaine).
yhaH protein networkhttps://string-db.org/network/866895.HBHAL_2210Hypothetical protein.
trpP protein networkhttps://string-db.org/network/866895.HBHAL_2211Probable tryptophan transport protein.
CCG44565.1 protein networkhttps://string-db.org/network/866895.HBHAL_2212Hit-like protein involved in cell-cycle regulation.
CCG44567.1 protein networkhttps://string-db.org/network/866895.HBHAL_2214ABC-type transport system ATP-binding protein.
CCG44568.1 protein networkhttps://string-db.org/network/866895.HBHAL_2215ABC-type transport system permease protein.
CCG44569.1 protein networkhttps://string-db.org/network/866895.HBHAL_2216Hypothetical protein.
ecsC protein networkhttps://string-db.org/network/866895.HBHAL_2217EcsC protein.
CCG44572.1 protein networkhttps://string-db.org/network/866895.HBHAL_2219Bacterioferritin.
CCG44573.1 protein networkhttps://string-db.org/network/866895.HBHAL_2220Conserved hypothetical protein.
CCG44574.1 protein networkhttps://string-db.org/network/866895.HBHAL_2221Two-component sensor histidine kinase.
CCG44575.1 protein networkhttps://string-db.org/network/866895.HBHAL_2222Two-component response regulator.
CCG44576.1 protein networkhttps://string-db.org/network/866895.HBHAL_2223Hypothetical protein.
CCG44577.1 protein networkhttps://string-db.org/network/866895.HBHAL_2224Hypothetical protein.
bdbC protein networkhttps://string-db.org/network/866895.HBHAL_2225Putative disulfide bond formation protein; Required for disulfide bond formation in some proteins. Belongs to the DsbB family. BdbC subfamily.
trxA4 protein networkhttps://string-db.org/network/866895.HBHAL_2226Thioredoxin.
yhgC protein networkhttps://string-db.org/network/866895.HBHAL_2227Conserved hypothetical protein.
pbpF protein networkhttps://string-db.org/network/866895.HBHAL_2228Penicillin binding protein 1F.
hemE protein networkhttps://string-db.org/network/866895.HBHAL_2229Uroporphyrinogen decarboxylase; Catalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III.
hemH protein networkhttps://string-db.org/network/866895.HBHAL_2230Ferrochelatase; Catalyzes the ferrous insertion into protoporphyrin IX. Belongs to the ferrochelatase family.
CCG44584.1 protein networkhttps://string-db.org/network/866895.HBHAL_2231Protoporphyrinogen oxidase; Catalyzes the 6-electron oxidation of protoporphyrinogen-IX to form protoporphyrin-IX.
CCG44585.1 protein networkhttps://string-db.org/network/866895.HBHAL_2232LacI family transcription regulator.
CCG44587.1 protein networkhttps://string-db.org/network/866895.HBHAL_2234Hypothetical protein.
yhfI protein networkhttps://string-db.org/network/866895.HBHAL_2235Beta-lactamase domain protein.
lplJ protein networkhttps://string-db.org/network/866895.HBHAL_2236Lipoate-protein ligase LplJ.
CCG44590.1 protein networkhttps://string-db.org/network/866895.HBHAL_2237long-chain-fatty-acid--CoA ligase.
CCG44591.1 protein networkhttps://string-db.org/network/866895.HBHAL_2238Hypothetical protein.
CCG44592.1 protein networkhttps://string-db.org/network/866895.HBHAL_2239Hypothetical protein.
CCG44593.1 protein networkhttps://string-db.org/network/866895.HBHAL_2240Hypothetical protein.
comK protein networkhttps://string-db.org/network/866895.HBHAL_2241Competence protein ComK.
CCG44595.1 protein networkhttps://string-db.org/network/866895.HBHAL_2242Conserved hypothetical protein.
yhjE protein networkhttps://string-db.org/network/866895.HBHAL_2243Conserved hypothetical protein.
sipT3 protein networkhttps://string-db.org/network/866895.HBHAL_2244Signal peptidase I; Belongs to the peptidase S26 family.
addB protein networkhttps://string-db.org/network/866895.HBHAL_2245ATP-dependent nuclease subunit B; ATP-dependent DNA helicase; Belongs to the helicase family. AddB/RexB type 1 subfamily.
addA protein networkhttps://string-db.org/network/866895.HBHAL_2246ATP-dependent helicase / nuclease subunit A; ATP-dependent DNA helicase.
yisB protein networkhttps://string-db.org/network/866895.HBHAL_2247Hypothetical protein.
yyaS4 protein networkhttps://string-db.org/network/866895.HBHAL_2248Conserved hypothetical protein.
CCG44602.1 protein networkhttps://string-db.org/network/866895.HBHAL_2249Hypothetical protein.
CCG44603.1 protein networkhttps://string-db.org/network/866895.HBHAL_2250IS1341-type transposase.
CCG44604.1 protein networkhttps://string-db.org/network/866895.HBHAL_2251LacI family transcription regulator.
CCG44605.1 protein networkhttps://string-db.org/network/866895.HBHAL_2252PTS system subunit IIBC, sucrose-specific.
CCG44606.1 protein networkhttps://string-db.org/network/866895.HBHAL_2253Sucrose-6-phosphate hydrolase; Enables the bacterium to metabolize sucrose as a sole carbon source; Belongs to the glycosyl hydrolase 32 family.
CCG44607.1 protein networkhttps://string-db.org/network/866895.HBHAL_2254Conserved hypothetical protein.
CCG44608.1 protein networkhttps://string-db.org/network/866895.HBHAL_2255Putative spore germination protein.
CCG44609.1 protein networkhttps://string-db.org/network/866895.HBHAL_2256Hypothetical protein.
CCG44610.1 protein networkhttps://string-db.org/network/866895.HBHAL_2257Putative spore germination protein.
CCG44611.1 protein networkhttps://string-db.org/network/866895.HBHAL_2259Hypothetical protein.
CCG44612.1 protein networkhttps://string-db.org/network/866895.HBHAL_2261Hypothetical protein.
yxaH protein networkhttps://string-db.org/network/866895.HBHAL_2262Conserved hypothetical protein.
CCG44614.1 protein networkhttps://string-db.org/network/866895.HBHAL_2263Conserved hypothetical protein.
CCG44615.1 protein networkhttps://string-db.org/network/866895.HBHAL_2264Conserved hypothetical protein.
rocD protein networkhttps://string-db.org/network/866895.HBHAL_2265Ornithine aminotransferase; Catalyzes the interconversion of ornithine to glutamate semialdehyde.
yisL protein networkhttps://string-db.org/network/866895.HBHAL_2266Hypothetical protein.
CCG44618.1 protein networkhttps://string-db.org/network/866895.HBHAL_2267Hypothetical protein.
asnO protein networkhttps://string-db.org/network/866895.HBHAL_2268Asparagine synthase.
CCG44620.1 protein networkhttps://string-db.org/network/866895.HBHAL_2269Alpha-amylase family protein.
CCG44621.1 protein networkhttps://string-db.org/network/866895.HBHAL_2271Conserved hypothetical protein.
degV1 protein networkhttps://string-db.org/network/866895.HBHAL_2272DegV family protein.
yitT protein networkhttps://string-db.org/network/866895.HBHAL_2273UPF0750 family protein.
CCG44624.1 protein networkhttps://string-db.org/network/866895.HBHAL_2274Intracellular proteinase inhibitor.
CCG44625.1 protein networkhttps://string-db.org/network/866895.HBHAL_2275Conserved hypothetical protein.
CCG44626.1 protein networkhttps://string-db.org/network/866895.HBHAL_2276Hypothetical protein.
CCG44627.1 protein networkhttps://string-db.org/network/866895.HBHAL_2277Hypothetical protein.
CCG44628.1 protein networkhttps://string-db.org/network/866895.HBHAL_2278HAD superfamily hydrolase.
CCG44629.1 protein networkhttps://string-db.org/network/866895.HBHAL_2279Hypothetical protein.
CCG44630.1 protein networkhttps://string-db.org/network/866895.HBHAL_2281Hypothetical protein.
CCG44631.1 protein networkhttps://string-db.org/network/866895.HBHAL_2282Hypothetical protein.
CCG44632.1 protein networkhttps://string-db.org/network/866895.HBHAL_2283HAD superfamily hydrolase.
yitV protein networkhttps://string-db.org/network/866895.HBHAL_2284Conserved hypothetical protein.
yitW protein networkhttps://string-db.org/network/866895.HBHAL_2285Hypothetical protein.
mobB protein networkhttps://string-db.org/network/866895.HBHAL_2286Molybdopterin-guanine dinucleotide biosynthesis protein MobB.
moaE protein networkhttps://string-db.org/network/866895.HBHAL_2287Molybdopterin converting factor subunit 2.
moaD protein networkhttps://string-db.org/network/866895.HBHAL_2288Molybdopterin synthase sulfur carrier subunit MoaD.
uppP2 protein networkhttps://string-db.org/network/866895.HBHAL_2289Undecaprenyl pyrophosphate phosphatase; Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin; Belongs to the UppP family.
CCG44639.1 protein networkhttps://string-db.org/network/866895.HBHAL_2290Hypothetical protein.
CCG44640.1 protein networkhttps://string-db.org/network/866895.HBHAL_2291Hypothetical protein.
med protein networkhttps://string-db.org/network/866895.HBHAL_2292Positive regulator of ComK.
CCG44642.1 protein networkhttps://string-db.org/network/866895.HBHAL_2293Hypothetical protein.
CCG44643.1 protein networkhttps://string-db.org/network/866895.HBHAL_2294Hypothetical protein.
fabH protein networkhttps://string-db.org/network/866895.HBHAL_22953-oxoacyl-(acyl carrier protein) synthase III; Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP. Catalyzes the first [...]
fabF protein networkhttps://string-db.org/network/866895.HBHAL_22963-oxoacyl-(acyl carrier protein) synthase II; Catalyzes the condensation reaction of fatty acid synthesis by the addition to an acyl acceptor of two carbons from malonyl-ACP.
CCG44646.1 protein networkhttps://string-db.org/network/866895.HBHAL_2298LytR family transcription regulator.
CCG44647.1 protein networkhttps://string-db.org/network/866895.HBHAL_2299Hypothetical protein.
yjbA protein networkhttps://string-db.org/network/866895.HBHAL_2300Hypothetical protein.
trpS protein networkhttps://string-db.org/network/866895.HBHAL_2301tryptophanyl-tRNA synthetase; Catalyzes the attachment of tryptophan to tRNA(Trp). Belongs to the class-I aminoacyl-tRNA synthetase family.
CCG44650.1 protein networkhttps://string-db.org/network/866895.HBHAL_2302Hypothetical protein.
CCG44651.1 protein networkhttps://string-db.org/network/866895.HBHAL_2303ABC-type transport system extracellular binding protein (probable substrate peptide/nickel).
CCG44652.1 protein networkhttps://string-db.org/network/866895.HBHAL_2304ABC-type transport system permease protein (probable substrate peptide/nickel).
CCG44653.1 protein networkhttps://string-db.org/network/866895.HBHAL_2305ABC-type transport system permease protein (probable substrate peptide/nickel).
CCG44654.1 protein networkhttps://string-db.org/network/866895.HBHAL_2306ABC-type transport system ATP-binding protein (probable substrate peptide/nickel); Belongs to the ABC transporter superfamily.
CCG44655.1 protein networkhttps://string-db.org/network/866895.HBHAL_2307ABC-type transport system ATP-binding protein (probable substrate peptide/nickel); Belongs to the ABC transporter superfamily.
CCG44656.1 protein networkhttps://string-db.org/network/866895.HBHAL_2309IS150-type transposase orfAB.
CCG44657.1 protein networkhttps://string-db.org/network/866895.HBHAL_2310Hypothetical protein.
yjbC protein networkhttps://string-db.org/network/866895.HBHAL_2312Hypothetical protein.
spxA protein networkhttps://string-db.org/network/866895.HBHAL_2313Transcription regulator Spx; Interferes with activator-stimulated transcription by interaction with the RNA polymerase alpha-CTD. May function to globally reduce transcription of genes involved i [...]
CCG44661.1 protein networkhttps://string-db.org/network/866895.HBHAL_2314Conserved hypothetical protein.
mecA protein networkhttps://string-db.org/network/866895.HBHAL_2315Adaptor protein; Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis. Acts negatively in the development of [...]
yjbF protein networkhttps://string-db.org/network/866895.HBHAL_2316Hypothetical protein.
pepF protein networkhttps://string-db.org/network/866895.HBHAL_2317Probable peptidase (homolog to oligoendopeptidase F).
CCG44665.1 protein networkhttps://string-db.org/network/866895.HBHAL_2318Hypothetical protein.
CCG44666.1 protein networkhttps://string-db.org/network/866895.HBHAL_2319Hypothetical protein.
CCG44667.1 protein networkhttps://string-db.org/network/866895.HBHAL_2320Hypothetical protein.
CCG44668.1 protein networkhttps://string-db.org/network/866895.HBHAL_2321Hypothetical protein.
yjbH protein networkhttps://string-db.org/network/866895.HBHAL_2322Hypothetical protein.
yjbI protein networkhttps://string-db.org/network/866895.HBHAL_2323Globin.
CCG44671.1 protein networkhttps://string-db.org/network/866895.HBHAL_2324CYTH domain protein.
CCG44672.1 protein networkhttps://string-db.org/network/866895.HBHAL_2325GTP pyrophosphokinase.
ppnK1 protein networkhttps://string-db.org/network/866895.HBHAL_2326Inorganic polyphosphate/ATP-NAD kinase; Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosph [...]
rluD2 protein networkhttps://string-db.org/network/866895.HBHAL_2327Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family.
prpA protein networkhttps://string-db.org/network/866895.HBHAL_2328Serine/threonine protein phosphatase; Asymmetrically hydrolyzes Ap4p to yield AMP and ATP.
CCG44676.1 protein networkhttps://string-db.org/network/866895.HBHAL_2329Cell cycle protein; Belongs to the SEDS family.
CCG44677.1 protein networkhttps://string-db.org/network/866895.HBHAL_2330MgtE family transporter (probable substrate magnesium); Acts as a magnesium transporter.
CCG44678.1 protein networkhttps://string-db.org/network/866895.HBHAL_2331Na+/H+ antiporter family protein; Belongs to the monovalent cation:proton antiporter 2 (CPA2) transporter (TC 2.A.37) family.
CCG44679.1 protein networkhttps://string-db.org/network/866895.HBHAL_2332Hypothetical protein.
CCG44680.1 protein networkhttps://string-db.org/network/866895.HBHAL_2333Hypothetical protein.
CCG44681.1 protein networkhttps://string-db.org/network/866895.HBHAL_2334Alpha/beta fold hydrolase.
CCG44682.1 protein networkhttps://string-db.org/network/866895.HBHAL_2335Group 2 glycosyltransferase.
CCG44683.1 protein networkhttps://string-db.org/network/866895.HBHAL_2336Conserved hypothetical protein.
CCG44684.1 protein networkhttps://string-db.org/network/866895.HBHAL_2338Hypothetical protein.
CCG44685.1 protein networkhttps://string-db.org/network/866895.HBHAL_2339Hypothetical protein.
CCG44686.1 protein networkhttps://string-db.org/network/866895.HBHAL_2340Hypothetical protein.
CCG44687.1 protein networkhttps://string-db.org/network/866895.HBHAL_2341Hypothetical protein.
CCG44688.1 protein networkhttps://string-db.org/network/866895.HBHAL_2342Hypothetical protein.
CCG44689.1 protein networkhttps://string-db.org/network/866895.HBHAL_2343Hypothetical protein.
CCG44690.1 protein networkhttps://string-db.org/network/866895.HBHAL_2344Hypothetical protein.
CCG44691.1 protein networkhttps://string-db.org/network/866895.HBHAL_2345Enoyl-(acyl carrier protein) reductase.
CCG44692.1 protein networkhttps://string-db.org/network/866895.HBHAL_2346Hypothetical protein.
CCG44693.1 protein networkhttps://string-db.org/network/866895.HBHAL_2347Spore coat protein.
CCG44694.1 protein networkhttps://string-db.org/network/866895.HBHAL_2348Hypothetical protein.
CCG44695.1 protein networkhttps://string-db.org/network/866895.HBHAL_2349Hypothetical protein.
yngL protein networkhttps://string-db.org/network/866895.HBHAL_2350Hypothetical protein.
CCG44697.1 protein networkhttps://string-db.org/network/866895.HBHAL_2351Hypothetical protein.
CCG44698.1 protein networkhttps://string-db.org/network/866895.HBHAL_2352Hypothetical protein.
CCG44699.1 protein networkhttps://string-db.org/network/866895.HBHAL_2353Hypothetical protein.
CCG44700.1 protein networkhttps://string-db.org/network/866895.HBHAL_2354Beta-lactamase domain protein.
yetF protein networkhttps://string-db.org/network/866895.HBHAL_2355Hypothetical protein.
CCG44702.1 protein networkhttps://string-db.org/network/866895.HBHAL_2356Acetyltransferase, GNAT family.
yjcG protein networkhttps://string-db.org/network/866895.HBHAL_2357UPF0477 family protein; Belongs to the 2H phosphoesterase superfamily. YjcG family.
yjcH protein networkhttps://string-db.org/network/866895.HBHAL_2358Conserved hypothetical protein.
CCG44705.1 protein networkhttps://string-db.org/network/866895.HBHAL_2359M10 family peptidase.
CCG44706.1 protein networkhttps://string-db.org/network/866895.HBHAL_2360Hypothetical protein.
CCG44707.1 protein networkhttps://string-db.org/network/866895.HBHAL_2361Hypothetical protein.
CCG44708.1 protein networkhttps://string-db.org/network/866895.HBHAL_2362Conserved hypothetical protein.
CCG44709.1 protein networkhttps://string-db.org/network/866895.HBHAL_2363Hypothetical protein.
CCG44710.1 protein networkhttps://string-db.org/network/866895.HBHAL_2364Hypothetical protein.
degV2 protein networkhttps://string-db.org/network/866895.HBHAL_2365DegV family protein.
CCG44714.1 protein networkhttps://string-db.org/network/866895.HBHAL_2368Conserved hypothetical protein.
CCG44715.1 protein networkhttps://string-db.org/network/866895.HBHAL_2369Conserved hypothetical protein.
hisC protein networkhttps://string-db.org/network/866895.HBHAL_2370Histidinol-phosphate aminotransferase; Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. Histidinol-phosphate aminotransferase subfamily.
pdhA1 protein networkhttps://string-db.org/network/866895.HBHAL_2371Pyruvate dehydrogenase subunit E1-alpha; The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic co [...]
pdhB1 protein networkhttps://string-db.org/network/866895.HBHAL_2372Pyruvate dehydrogenase subunit E1-beta.
CCG44719.1 protein networkhttps://string-db.org/network/866895.HBHAL_2373Pyruvate dehydrogenase subunit E2.
CCG44720.1 protein networkhttps://string-db.org/network/866895.HBHAL_2374Na+/H+ antiporter family protein.
CCG44721.1 protein networkhttps://string-db.org/network/866895.HBHAL_2375Conserved hypothetical protein.
hpaG1 protein networkhttps://string-db.org/network/866895.HBHAL_23764-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase subunit HpaG1.
hpaG2 protein networkhttps://string-db.org/network/866895.HBHAL_23774-hydroxyphenylacetate degradation bifunctional isomerase/decarboxylase subunit HpaG2.
hpcD protein networkhttps://string-db.org/network/866895.HBHAL_23785-carboxymethyl-2-hydroxymuconate delta-isomerase.
HBHAL_2381 protein networkhttps://string-db.org/network/866895.HBHAL_2381Locus_tag: HBHAL_2380; product: SSS family transporter (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MNLSVLIPLCLAYMAVMSLLAYYGYKKTTSEADYLVGGRNINPVV [...]
CCG44727.1 protein networkhttps://string-db.org/network/866895.HBHAL_23825-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
hpaB protein networkhttps://string-db.org/network/866895.HBHAL_23834-hydroxyphenylacetate-3-hydroxylase.
hpaD protein networkhttps://string-db.org/network/866895.HBHAL_23843,4-dihydroxyphenylacetate 2,3-dioxygenase.
CCG44730.1 protein networkhttps://string-db.org/network/866895.HBHAL_2385Flavin reductase domain protein FMN-binding.
CCG44731.1 protein networkhttps://string-db.org/network/866895.HBHAL_2386Bifunctional riboflavin kinase / FMN adenylyltransferase.
dapA1 protein networkhttps://string-db.org/network/866895.HBHAL_2387Dihydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA).
CCG44733.1 protein networkhttps://string-db.org/network/866895.HBHAL_2388Hypothetical protein.
CCG44734.1 protein networkhttps://string-db.org/network/866895.HBHAL_2389Putative carboxypeptidase.
CCG44735.1 protein networkhttps://string-db.org/network/866895.HBHAL_2390Conserved hypothetical protein.
HBHAL_2392 protein networkhttps://string-db.org/network/866895.HBHAL_2392Locus_tag: HBHAL_2391; product: potassium channel protein (nonfunctional); gene has a frameshift and is truncated at the N-terminus; conceptual translation after in silico reconstruction: AYESTLF [...]
CCG44738.1 protein networkhttps://string-db.org/network/866895.HBHAL_23934-aminobutyrate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
gabD protein networkhttps://string-db.org/network/866895.HBHAL_2394Succinate-semialdehyde dehydrogenase.
CCG44740.1 protein networkhttps://string-db.org/network/866895.HBHAL_2395Hypothetical protein.
CCG44741.1 protein networkhttps://string-db.org/network/866895.HBHAL_2396Sodium/panthothenate symporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
amaB protein networkhttps://string-db.org/network/866895.HBHAL_2397Allantoate amidohydrolase.
argE protein networkhttps://string-db.org/network/866895.HBHAL_2398Acetylornithine deacetylase.
CCG44745.1 protein networkhttps://string-db.org/network/866895.HBHAL_2400Conserved hypothetical protein.
CCG44746.1 protein networkhttps://string-db.org/network/866895.HBHAL_2401Amino acid permease-associated region.
CCG44747.1 protein networkhttps://string-db.org/network/866895.HBHAL_2402Conserved hypothetical protein.
CCG44748.1 protein networkhttps://string-db.org/network/866895.HBHAL_2403Hypothetical protein.
CCG44749.1 protein networkhttps://string-db.org/network/866895.HBHAL_2404Hypothetical protein.
CCG44750.1 protein networkhttps://string-db.org/network/866895.HBHAL_2405Hypothetical protein.
CCG44751.1 protein networkhttps://string-db.org/network/866895.HBHAL_2406Hypothetical protein.
fliC protein networkhttps://string-db.org/network/866895.HBHAL_2407Flagellin; Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella.
CCG44753.1 protein networkhttps://string-db.org/network/866895.HBHAL_2408Conserved hypothetical protein.
CCG44754.1 protein networkhttps://string-db.org/network/866895.HBHAL_2409Diguanylate cyclase domain protein.
mqo-2 protein networkhttps://string-db.org/network/866895.HBHAL_2410Malate dehydrogenase (quinone).
CCG44756.1 protein networkhttps://string-db.org/network/866895.HBHAL_2411L-lactate permease family transporter; Transports L-lactate across the membrane. Can also transport D-lactate and glycolate; Belongs to the lactate permease family.
gsiB protein networkhttps://string-db.org/network/866895.HBHAL_2412General stress protein.
CCG44758.1 protein networkhttps://string-db.org/network/866895.HBHAL_2413Conserved hypothetical protein.
CCG44759.1 protein networkhttps://string-db.org/network/866895.HBHAL_2414Conserved hypothetical protein.
CCG44760.1 protein networkhttps://string-db.org/network/866895.HBHAL_2415Conserved hypothetical protein.
traI protein networkhttps://string-db.org/network/866895.HBHAL_2416DNA topoisomerase III.
CCG44762.1 protein networkhttps://string-db.org/network/866895.HBHAL_2417Hypothetical protein.
CCG44763.1 protein networkhttps://string-db.org/network/866895.HBHAL_2418Hypothetical protein; Belongs to the TelA family.
CCG44764.1 protein networkhttps://string-db.org/network/866895.HBHAL_2419Hypothetical protein.
CCG44765.1 protein networkhttps://string-db.org/network/866895.HBHAL_2420Conserved hypothetical protein.
CCG44766.1 protein networkhttps://string-db.org/network/866895.HBHAL_2421Heavy metal-transporting P-type ATPase.
CCG44767.1 protein networkhttps://string-db.org/network/866895.HBHAL_2422Hypothetical protein.
CCG44768.1 protein networkhttps://string-db.org/network/866895.HBHAL_2423Sulfate transporter familiy protein.
CCG44769.1 protein networkhttps://string-db.org/network/866895.HBHAL_2424UDP-glucose/GDP-mannose dehydrogenase; Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
CCG44770.1 protein networkhttps://string-db.org/network/866895.HBHAL_2425Glutamine--scyllo-inositol aminotransferase; Belongs to the DegT/DnrJ/EryC1 family.
CCG44771.1 protein networkhttps://string-db.org/network/866895.HBHAL_2426Oxidoreductase domain protein.
CCG44772.1 protein networkhttps://string-db.org/network/866895.HBHAL_2427Transferase hexapeptide repeat containing protein.
CCG44774.1 protein networkhttps://string-db.org/network/866895.HBHAL_2429Hypothetical protein.
CCG44775.1 protein networkhttps://string-db.org/network/866895.HBHAL_2430Hypothetical protein.
CCG44776.1 protein networkhttps://string-db.org/network/866895.HBHAL_2432Hypothetical protein.
CCG44777.1 protein networkhttps://string-db.org/network/866895.HBHAL_2433Hypothetical protein.
CCG44778.1 protein networkhttps://string-db.org/network/866895.HBHAL_2434Hypothetical protein.
CCG44779.1 protein networkhttps://string-db.org/network/866895.HBHAL_2435Group 2 glycosyltransferase.
CCG44780.1 protein networkhttps://string-db.org/network/866895.HBHAL_2436Group 1 glycosyltransferase.
CCG44781.1 protein networkhttps://string-db.org/network/866895.HBHAL_2437ABC-type transport system permease protein.
CCG44782.1 protein networkhttps://string-db.org/network/866895.HBHAL_2438ABC-type transport system ATP-binding protein.
CCG44783.1 protein networkhttps://string-db.org/network/866895.HBHAL_2439Hypothetical protein.
dhlB protein networkhttps://string-db.org/network/866895.HBHAL_2440Haloacid dehalogenase, type II.
CCG44785.1 protein networkhttps://string-db.org/network/866895.HBHAL_2441CRP/FNR family transcription regulator.
yqgS2 protein networkhttps://string-db.org/network/866895.HBHAL_2442YqgS family protein; Belongs to the LTA synthase family.
CCG44788.1 protein networkhttps://string-db.org/network/866895.HBHAL_2444Hypothetical protein.
CCG44789.1 protein networkhttps://string-db.org/network/866895.HBHAL_2445Hypothetical protein.
uspA2 protein networkhttps://string-db.org/network/866895.HBHAL_2446UspA domain protein.
CCG44791.1 protein networkhttps://string-db.org/network/866895.HBHAL_2447Sulfate transporter familiy protein.
uspA3 protein networkhttps://string-db.org/network/866895.HBHAL_2448UspA domain protein.
CCG44793.1 protein networkhttps://string-db.org/network/866895.HBHAL_2449DNA binding domain, excisionase family.
CCG44794.1 protein networkhttps://string-db.org/network/866895.HBHAL_2450DedA family protein.
CCG44795.1 protein networkhttps://string-db.org/network/866895.HBHAL_2451Na+/Ca2+ antiporter family protein.
CCG44796.1 protein networkhttps://string-db.org/network/866895.HBHAL_2452Hypothetical protein.
CCG44797.1 protein networkhttps://string-db.org/network/866895.HBHAL_2453Conserved hypothetical protein.
mtnN2 protein networkhttps://string-db.org/network/866895.HBHAL_24545'-methylthioadenosine/ S-adenosylhomocysteinenucleosidase; Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) [...]
HBHAL_2460 protein networkhttps://string-db.org/network/866895.HBHAL_2460Locus_tag: HBHAL_2459; product: putative cyclic nucleotide binding regulatory protein (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MKDVLIQYMKRFSD [...]
ppdK protein networkhttps://string-db.org/network/866895.HBHAL_2461Pyruvate, phosphate dikinase; Belongs to the PEP-utilizing enzyme family.
yqfL2 protein networkhttps://string-db.org/network/866895.HBHAL_2462Probable phosphotransferase YqfL; Bifunctional serine/threonine kinase and phosphorylase involved in the regulation of the pyruvate, phosphate dikinase (PPDK) by catalyzing its phosphorylation/de [...]
pfkA1 protein networkhttps://string-db.org/network/866895.HBHAL_24636-phosphofructokinase; Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis; Belongs to the phosphofructokinase typ [...]
CCG44808.1 protein networkhttps://string-db.org/network/866895.HBHAL_2465Hypothetical protein.
CCG44809.1 protein networkhttps://string-db.org/network/866895.HBHAL_2466Hypothetical protein.
CCG44810.1 protein networkhttps://string-db.org/network/866895.HBHAL_2467ABC-type transport system extracellular binding protein (probable substrate Mn/Zn); Belongs to the bacterial solute-binding protein 9 family.
CCG44811.1 protein networkhttps://string-db.org/network/866895.HBHAL_2468Hypothetical protein.
CCG44812.1 protein networkhttps://string-db.org/network/866895.HBHAL_2469CopC domain protein.
CCG44813.1 protein networkhttps://string-db.org/network/866895.HBHAL_2470Transport protein (probable substrate copper).
sodF protein networkhttps://string-db.org/network/866895.HBHAL_2471Superoxide dismutase (Fe).
ybbC protein networkhttps://string-db.org/network/866895.HBHAL_2473O-glycosyl hydrolase family protein (homolog to N-acetylglucosaminidase); Belongs to the glycosyl hydrolase 3 family.
CCG44817.1 protein networkhttps://string-db.org/network/866895.HBHAL_2474Hypothetical protein.
CCG44818.1 protein networkhttps://string-db.org/network/866895.HBHAL_2475ABC-type transport system extracellular binding protein.
CCG44819.1 protein networkhttps://string-db.org/network/866895.HBHAL_2476ABC-type transport system permease protein.
CCG44820.1 protein networkhttps://string-db.org/network/866895.HBHAL_2477ABC-type transport system permease protein.
malL1 protein networkhttps://string-db.org/network/866895.HBHAL_2478Oligo-1,6-glucosidase.
CCG44823.1 protein networkhttps://string-db.org/network/866895.HBHAL_2480Hypothetical protein.
CCG44824.1 protein networkhttps://string-db.org/network/866895.HBHAL_2481Hypothetical protein.
CCG44825.1 protein networkhttps://string-db.org/network/866895.HBHAL_2482Hypothetical protein.
CCG44829.1 protein networkhttps://string-db.org/network/866895.HBHAL_2486Hypothetical protein.
CCG44830.1 protein networkhttps://string-db.org/network/866895.HBHAL_2487Hypothetical protein.
CCG44831.1 protein networkhttps://string-db.org/network/866895.HBHAL_2488Hypothetical protein.
CCG44832.1 protein networkhttps://string-db.org/network/866895.HBHAL_2488_AConserved hypothetical protein.
CCG44833.1 protein networkhttps://string-db.org/network/866895.HBHAL_2489Group II intron reverse transcriptase/maturase.
CCG44835.1 protein networkhttps://string-db.org/network/866895.HBHAL_2491Hypothetical protein.
CCG44836.1 protein networkhttps://string-db.org/network/866895.HBHAL_2492Hypothetical protein.
CCG44837.1 protein networkhttps://string-db.org/network/866895.HBHAL_2493Group II intron reverse transcriptase/maturase.
CCG44838.1 protein networkhttps://string-db.org/network/866895.HBHAL_2494Hypothetical protein.
CCG44839.1 protein networkhttps://string-db.org/network/866895.HBHAL_2495Hypothetical protein.
CCG44844.1 protein networkhttps://string-db.org/network/866895.HBHAL_2500Hypothetical protein.
CCG44845.1 protein networkhttps://string-db.org/network/866895.HBHAL_2501Hypothetical protein.
CCG44846.1 protein networkhttps://string-db.org/network/866895.HBHAL_2502Hypothetical protein.
CCG44847.1 protein networkhttps://string-db.org/network/866895.HBHAL_2503Hypothetical protein.
CCG44848.1 protein networkhttps://string-db.org/network/866895.HBHAL_2504Hypothetical protein.
CCG44850.1 protein networkhttps://string-db.org/network/866895.HBHAL_2505_AConserved hypothetical protein.
CCG44851.1 protein networkhttps://string-db.org/network/866895.HBHAL_2506Hypothetical protein.
CCG44852.1 protein networkhttps://string-db.org/network/866895.HBHAL_2507Hypothetical protein.
CCG44853.1 protein networkhttps://string-db.org/network/866895.HBHAL_2508Hypothetical protein.
CCG44857.1 protein networkhttps://string-db.org/network/866895.HBHAL_2512Hypothetical protein.
yckC2 protein networkhttps://string-db.org/network/866895.HBHAL_2513RDD domain protein.
CCG44860.1 protein networkhttps://string-db.org/network/866895.HBHAL_2515Group II intron reverse transcriptase/maturase.
CCG44861.1 protein networkhttps://string-db.org/network/866895.HBHAL_2516_AConserved hypothetical protein.
CCG44862.1 protein networkhttps://string-db.org/network/866895.HBHAL_2517Phosphatidylserine decarboxylase; Catalyzes the formation of phosphatidylethanolamine (PtdEtn) from phosphatidylserine (PtdSer).
CCG44863.1 protein networkhttps://string-db.org/network/866895.HBHAL_2518Hypothetical protein.
CCG44864.1 protein networkhttps://string-db.org/network/866895.HBHAL_2519Conserved hypothetical protein.
CCG44865.1 protein networkhttps://string-db.org/network/866895.HBHAL_2520Alpha/beta fold hydrolase.
CCG44866.1 protein networkhttps://string-db.org/network/866895.HBHAL_2521Hypothetical protein.
CCG44867.1 protein networkhttps://string-db.org/network/866895.HBHAL_2522Conserved hypothetical protein.
CCG44868.1 protein networkhttps://string-db.org/network/866895.HBHAL_2523Hypothetical protein.
CCG44869.1 protein networkhttps://string-db.org/network/866895.HBHAL_2524Hypothetical protein.
CCG44870.1 protein networkhttps://string-db.org/network/866895.HBHAL_2525Hypothetical protein; Belongs to the phosphatidylserine decarboxylase family.
CCG44871.1 protein networkhttps://string-db.org/network/866895.HBHAL_2526Hypothetical protein.
CCG44872.1 protein networkhttps://string-db.org/network/866895.HBHAL_2527Hypothetical protein.
yhjG1 protein networkhttps://string-db.org/network/866895.HBHAL_2528FAD-dependent oxidoreductase.
CCG44874.1 protein networkhttps://string-db.org/network/866895.HBHAL_2529Hypothetical protein.
CCG44875.1 protein networkhttps://string-db.org/network/866895.HBHAL_2530Hypothetical protein.
CCG44876.1 protein networkhttps://string-db.org/network/866895.HBHAL_2531Hypothetical protein.
yrkC1 protein networkhttps://string-db.org/network/866895.HBHAL_2532Conserved hypothetical protein.
CCG44879.1 protein networkhttps://string-db.org/network/866895.HBHAL_2534Hypothetical protein.
CCG44880.1 protein networkhttps://string-db.org/network/866895.HBHAL_2535Conserved hypothetical protein.
CCG44881.1 protein networkhttps://string-db.org/network/866895.HBHAL_2536Hypothetical protein.
CCG44882.1 protein networkhttps://string-db.org/network/866895.HBHAL_2536_AConserved hypothetical protein.
yckC3 protein networkhttps://string-db.org/network/866895.HBHAL_2537RDD domain protein.
purT protein networkhttps://string-db.org/network/866895.HBHAL_2538Phosphoribosylglycinamide formyltransferase; Involved in the de novo purine biosynthesis. Catalyzes the transfer of formate to 5-phospho-ribosyl-glycinamide (GAR), producing 5-phospho-ribosyl-N-f [...]
CCG44885.1 protein networkhttps://string-db.org/network/866895.HBHAL_2539Hypothetical protein.
CCG44887.1 protein networkhttps://string-db.org/network/866895.HBHAL_2541Conserved hypothetical protein.
CCG44888.1 protein networkhttps://string-db.org/network/866895.HBHAL_2542Hypothetical protein.
CCG44889.1 protein networkhttps://string-db.org/network/866895.HBHAL_2543Conserved hypothetical protein.
yrkC2 protein networkhttps://string-db.org/network/866895.HBHAL_2544Conserved hypothetical protein.
CCG44891.1 protein networkhttps://string-db.org/network/866895.HBHAL_2545Hypothetical protein.
CCG44892.1 protein networkhttps://string-db.org/network/866895.HBHAL_2546Hypothetical protein.
CCG44893.1 protein networkhttps://string-db.org/network/866895.HBHAL_2547Hypothetical protein.
CCG44894.1 protein networkhttps://string-db.org/network/866895.HBHAL_2548Short-chain dehydrogenase/reductase family protein.
CCG44895.1 protein networkhttps://string-db.org/network/866895.HBHAL_2549Hypothetical protein.
CCG44896.1 protein networkhttps://string-db.org/network/866895.HBHAL_2550Hypothetical protein.
uppP1 protein networkhttps://string-db.org/network/866895.HBHAL_2551Undecaprenyl pyrophosphate phosphatase; Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin; Belongs to the UppP family.
CCG44898.1 protein networkhttps://string-db.org/network/866895.HBHAL_2552Conserved hypothetical protein.
CCG44899.1 protein networkhttps://string-db.org/network/866895.HBHAL_2553Hypothetical protein.
CCG44900.1 protein networkhttps://string-db.org/network/866895.HBHAL_2554Hypothetical protein.
CCG44901.1 protein networkhttps://string-db.org/network/866895.HBHAL_2555Hypothetical protein.
CCG44902.1 protein networkhttps://string-db.org/network/866895.HBHAL_2556Hypothetical protein.
CCG44903.1 protein networkhttps://string-db.org/network/866895.HBHAL_2557Hypothetical protein.
azoR protein networkhttps://string-db.org/network/866895.HBHAL_2558FMN-dependent NADH-azoreductase; Catalyzes the reductive cleavage of azo bond in aromatic azo compounds to the corresponding amines. Requires NADH, but not NADPH, as an electron donor for its act [...]
CCG44905.1 protein networkhttps://string-db.org/network/866895.HBHAL_2559Oxidoreductase, Gfo/Idh/MocA family.
CCG44906.1 protein networkhttps://string-db.org/network/866895.HBHAL_2560Sodium/solute symporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
osmC2 protein networkhttps://string-db.org/network/866895.HBHAL_2561OsmC family protein.
CCG44908.1 protein networkhttps://string-db.org/network/866895.HBHAL_2562Putative drug/metabolite exporter family protein.
CCG44909.1 protein networkhttps://string-db.org/network/866895.HBHAL_2563Hypothetical protein.
CCG44910.1 protein networkhttps://string-db.org/network/866895.HBHAL_2564IS231-type transposase.
CCG44911.1 protein networkhttps://string-db.org/network/866895.HBHAL_2565Hypothetical protein.
tlpA protein networkhttps://string-db.org/network/866895.HBHAL_2566Methyl-accepting chemotaxis protein.
CCG44913.1 protein networkhttps://string-db.org/network/866895.HBHAL_2567Hypothetical protein; Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporte [...]
CCG44914.1 protein networkhttps://string-db.org/network/866895.HBHAL_2568Hypothetical protein.
ilvE-2 protein networkhttps://string-db.org/network/866895.HBHAL_2569Branched-chain amino acid aminotransferase; Acts on leucine, isoleucine and valine. Belongs to the class-IV pyridoxal-phosphate-dependent aminotransferase family.
ilvB3 protein networkhttps://string-db.org/network/866895.HBHAL_2570Acetolactate synthase large subunit.
ilvH protein networkhttps://string-db.org/network/866895.HBHAL_2571Acetolactate synthase small subunit.
ilvC protein networkhttps://string-db.org/network/866895.HBHAL_2572Ketol-acid reductoisomerase; Involved in the biosynthesis of branched-chain amino acids (BCAA). Catalyzes an alkyl-migration followed by a ketol-acid reduction of (S)-2-acetolactate (S2AL) to yie [...]
leuA protein networkhttps://string-db.org/network/866895.HBHAL_25732-isopropylmalate synthase; Catalyzes the condensation of the acetyl group of acetyl-CoA with 3-methyl-2-oxobutanoate (2-oxoisovalerate) to form 3-carboxy-3- hydroxy-4-methylpentanoate (2-isoprop [...]
leuB protein networkhttps://string-db.org/network/866895.HBHAL_25743-isopropylmalate dehydrogenase; Catalyzes the oxidation of 3-carboxy-2-hydroxy-4- methylpentanoate (3-isopropylmalate) to 3-carboxy-4-methyl-2- oxopentanoate. The product decarboxylates to 4-met [...]
leuC protein networkhttps://string-db.org/network/866895.HBHAL_25753-isopropylmalate dehydratase large subunit; Catalyzes the isomerization between 2-isopropylmalate and 3- isopropylmalate, via the formation of 2-isopropylmaleate.
leuD protein networkhttps://string-db.org/network/866895.HBHAL_25763-isopropylmalate dehydratase small subunit; Catalyzes the isomerization between 2-isopropylmalate and 3- isopropylmalate, via the formation of 2-isopropylmaleate. Belongs to the LeuD family. Leu [...]
ilvA protein networkhttps://string-db.org/network/866895.HBHAL_2577Threonine ammonia-lyase; Catalyzes the anaerobic formation of alpha-ketobutyrate and ammonia from threonine in a two-step reaction. The first step involved a dehydration of threonine and a produc [...]
CCG44924.1 protein networkhttps://string-db.org/network/866895.HBHAL_2578ABC-type transport system extracellular binding protein (probable substrate iron complex).
CCG44925.1 protein networkhttps://string-db.org/network/866895.HBHAL_2579ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.
CCG44926.1 protein networkhttps://string-db.org/network/866895.HBHAL_2580Hypothetical protein.
yhjG2 protein networkhttps://string-db.org/network/866895.HBHAL_2581FAD-dependent oxidoreductase.
CCG44928.1 protein networkhttps://string-db.org/network/866895.HBHAL_2582Hypothetical protein.
CCG44929.1 protein networkhttps://string-db.org/network/866895.HBHAL_2583MarR family transcription regulator.
ywoG protein networkhttps://string-db.org/network/866895.HBHAL_2584MFS-type transporter YwoG.
ykoY2 protein networkhttps://string-db.org/network/866895.HBHAL_2585TerC family protein.
CCG44933.1 protein networkhttps://string-db.org/network/866895.HBHAL_2587Hypothetical protein.
CCG44934.1 protein networkhttps://string-db.org/network/866895.HBHAL_2588Hypothetical protein.
CCG44936.1 protein networkhttps://string-db.org/network/866895.HBHAL_2590Hypothetical protein.
CCG44937.1 protein networkhttps://string-db.org/network/866895.HBHAL_2591Hypothetical protein.
CCG44938.1 protein networkhttps://string-db.org/network/866895.HBHAL_2592Hypothetical protein.
cwlJ1 protein networkhttps://string-db.org/network/866895.HBHAL_2593Cell wall hydrolase CwlJ.
ykkC protein networkhttps://string-db.org/network/866895.HBHAL_2594Small multidrug resistance protein.
ykkD protein networkhttps://string-db.org/network/866895.HBHAL_2595Small multidrug resistance protein.
CCG44942.1 protein networkhttps://string-db.org/network/866895.HBHAL_2596TetR family transcription regulator.
CCG44943.1 protein networkhttps://string-db.org/network/866895.HBHAL_2597Hypothetical protein.
yoaS protein networkhttps://string-db.org/network/866895.HBHAL_2598Hypothetical protein.
yozG protein networkhttps://string-db.org/network/866895.HBHAL_2599YozG family transcription regulator.
yoaT protein networkhttps://string-db.org/network/866895.HBHAL_2600Hypothetical protein.
CCG44947.1 protein networkhttps://string-db.org/network/866895.HBHAL_2601Short-chain dehydrogenase/reductase family protein.
fbp1 protein networkhttps://string-db.org/network/866895.HBHAL_2602Fructose 1,6-bisphosphatase, class III.
CCG44949.1 protein networkhttps://string-db.org/network/866895.HBHAL_2603Conserved hypothetical protein.
CCG44950.1 protein networkhttps://string-db.org/network/866895.HBHAL_2604Hypothetical protein.
CCG44952.1 protein networkhttps://string-db.org/network/866895.HBHAL_2606Hypothetical protein.
ydaH protein networkhttps://string-db.org/network/866895.HBHAL_2607Conserved hypothetical protein; Involved in peptidoglycan biosynthesis. Transports lipid- linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane.
HBHAL_2609 protein networkhttps://string-db.org/network/866895.HBHAL_2609Short-chain dehydrogenase/reductase family protein (nonfunctional).
yqjT protein networkhttps://string-db.org/network/866895.HBHAL_2610Glyoxalase domain protein.
CCG44957.1 protein networkhttps://string-db.org/network/866895.HBHAL_2611Hypothetical protein.
CCG44958.1 protein networkhttps://string-db.org/network/866895.HBHAL_2612Hypothetical protein.
CCG44959.1 protein networkhttps://string-db.org/network/866895.HBHAL_2613Hypothetical protein.
CCG44960.1 protein networkhttps://string-db.org/network/866895.HBHAL_2614IS110-type transposase.
HBHAL_2615_B protein networkhttps://string-db.org/network/866895.HBHAL_2615_BLocus_tag: HBHAL_2615_A; product: VanZ family protein (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MQPLGYSYDLSPPLFLIVFTVICGITFLYLHLKNKKKKKNFKKLL [...]
CCG44964.1 protein networkhttps://string-db.org/network/866895.HBHAL_2616Hypothetical protein.
CCG44965.1 protein networkhttps://string-db.org/network/866895.HBHAL_2616_AConserved hypothetical protein.
CCG44966.1 protein networkhttps://string-db.org/network/866895.HBHAL_2616_BConserved hypothetical protein.
CCG44967.1 protein networkhttps://string-db.org/network/866895.HBHAL_2617Hypothetical protein.
CCG44968.1 protein networkhttps://string-db.org/network/866895.HBHAL_2618Hypothetical protein.
CCG44969.1 protein networkhttps://string-db.org/network/866895.HBHAL_2618_AConserved hypothetical protein.
CCG44970.1 protein networkhttps://string-db.org/network/866895.HBHAL_2619Hypothetical protein.
CCG44971.1 protein networkhttps://string-db.org/network/866895.HBHAL_2620Hypothetical protein.
CCG44972.1 protein networkhttps://string-db.org/network/866895.HBHAL_2621Hypothetical protein.
CCG44973.1 protein networkhttps://string-db.org/network/866895.HBHAL_2622Hypothetical protein.
CCG44974.1 protein networkhttps://string-db.org/network/866895.HBHAL_2623Lactoylglutathione lyase.
CCG44975.1 protein networkhttps://string-db.org/network/866895.HBHAL_2624Conserved hypothetical protein.
CCG44976.1 protein networkhttps://string-db.org/network/866895.HBHAL_2625Hypothetical protein.
CCG44977.1 protein networkhttps://string-db.org/network/866895.HBHAL_2626Zinc-binding alcohol dehydrogenase family protein; Belongs to the zinc-containing alcohol dehydrogenase family. Quinone oxidoreductase subfamily.
dapF protein networkhttps://string-db.org/network/866895.HBHAL_2627Diaminopimelate epimerase; Catalyzes the stereoinversion of LL-2,6-diaminoheptanedioate (L,L-DAP) to meso-diaminoheptanedioate (meso-DAP), a precursor of L- lysine and an essential component of t [...]
yugU protein networkhttps://string-db.org/network/866895.HBHAL_2628Hypothetical protein.
CCG44981.1 protein networkhttps://string-db.org/network/866895.HBHAL_2630Conserved hypothetical protein.
CCG44982.1 protein networkhttps://string-db.org/network/866895.HBHAL_2631LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family.
CCG44983.1 protein networkhttps://string-db.org/network/866895.HBHAL_2632Small multidrug resistance protein.
yvaE protein networkhttps://string-db.org/network/866895.HBHAL_2633Small multidrug resistance protein.
CCG44985.1 protein networkhttps://string-db.org/network/866895.HBHAL_2634Conserved hypothetical protein.
CCG44986.1 protein networkhttps://string-db.org/network/866895.HBHAL_2635Hypothetical protein.
CCG44987.1 protein networkhttps://string-db.org/network/866895.HBHAL_2636Hypothetical protein.
yocH6 protein networkhttps://string-db.org/network/866895.HBHAL_2637Conserved hypothetical protein.
CCG44990.1 protein networkhttps://string-db.org/network/866895.HBHAL_2639IS1341-type transposase.
zupT protein networkhttps://string-db.org/network/866895.HBHAL_2640Zinc/iron permease family protein; Mediates zinc uptake. May also transport other divalent cations; Belongs to the ZIP transporter (TC 2.A.5) family. ZupT subfamily.
iolA protein networkhttps://string-db.org/network/866895.HBHAL_2641Methylmalonic acid semialdehyde dehydrogenase; Catalyzes the oxidation of malonate semialdehyde (MSA) and methylmalonate semialdehyde (MMSA) into acetyl-CoA and propanoyl-CoA, respectively.
CCG44993.1 protein networkhttps://string-db.org/network/866895.HBHAL_2642Beta-ureidopropionase.
gltB2 protein networkhttps://string-db.org/network/866895.HBHAL_2643Glutamate synthase small subunit.
CCG44995.1 protein networkhttps://string-db.org/network/866895.HBHAL_2644Dihydropyrimidine dehydrogenase.
pydB protein networkhttps://string-db.org/network/866895.HBHAL_2645Dihydropyrimidinase.
CCG44997.1 protein networkhttps://string-db.org/network/866895.HBHAL_2647IS150-type transposase orfAB.
CCG44998.1 protein networkhttps://string-db.org/network/866895.HBHAL_2648Nucleobase:cation symporter-1, NCS1 family; Nucleobase/cation symporter-1 family protein (probable substrate cytosine/purines, uracil, thiamine,allantoin).
CCG44999.1 protein networkhttps://string-db.org/network/866895.HBHAL_2649Hypothetical protein.
CCG45000.1 protein networkhttps://string-db.org/network/866895.HBHAL_2650PucR family transcription regulator.
CCG45001.1 protein networkhttps://string-db.org/network/866895.HBHAL_2651Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
ald1 protein networkhttps://string-db.org/network/866895.HBHAL_2652Alanine dehydrogenase; Belongs to the AlaDH/PNT family.
CCG45003.1 protein networkhttps://string-db.org/network/866895.HBHAL_2653ArsR family transcription regulator.
CCG45004.1 protein networkhttps://string-db.org/network/866895.HBHAL_2654Heavy metal-transporting P-type ATPase (probable substrate cadmium).
CCG45005.1 protein networkhttps://string-db.org/network/866895.HBHAL_2655ISL3-type transposase.
CCG45006.1 protein networkhttps://string-db.org/network/866895.HBHAL_2656Hypothetical protein.
CCG45007.1 protein networkhttps://string-db.org/network/866895.HBHAL_2657Hypothetical protein.
CCG45008.1 protein networkhttps://string-db.org/network/866895.HBHAL_2658Hypothetical protein.
CCG45009.1 protein networkhttps://string-db.org/network/866895.HBHAL_2659IS1341-type transposase.
CCG45010.1 protein networkhttps://string-db.org/network/866895.HBHAL_2660Hypothetical protein.
CCG45011.1 protein networkhttps://string-db.org/network/866895.HBHAL_2661ABC-type transport system permease protein.
sspH protein networkhttps://string-db.org/network/866895.HBHAL_2662Small acid-soluble spore protein; Belongs to the SspH family.
CCG45013.1 protein networkhttps://string-db.org/network/866895.HBHAL_2663Probable glycerol dehydrogenase.
mtnX protein networkhttps://string-db.org/network/866895.HBHAL_26642-hydroxy-3-keto-5-methylthiopentenyl-1- phosphatephosphatase.
CCG45015.1 protein networkhttps://string-db.org/network/866895.HBHAL_2665Peptidoglycan-binding LysM.
CCG45016.1 protein networkhttps://string-db.org/network/866895.HBHAL_2666Hypothetical protein.
yojL protein networkhttps://string-db.org/network/866895.HBHAL_2667Conserved hypothetical protein.
CCG45018.1 protein networkhttps://string-db.org/network/866895.HBHAL_2668Hypothetical protein.
CCG45019.1 protein networkhttps://string-db.org/network/866895.HBHAL_2669Hypothetical protein.
CCG45020.1 protein networkhttps://string-db.org/network/866895.HBHAL_2670Hypothetical protein.
CCG45021.1 protein networkhttps://string-db.org/network/866895.HBHAL_2671Conserved hypothetical protein.
CCG45022.1 protein networkhttps://string-db.org/network/866895.HBHAL_2672Conserved hypothetical protein.
CCG45024.1 protein networkhttps://string-db.org/network/866895.HBHAL_2674Hypothetical protein.
cysH protein networkhttps://string-db.org/network/866895.HBHAL_2675Phosphoadenosine phosphosulfate reductase; Reduction of activated sulfate into sulfite. Belongs to the PAPS reductase family. CysH subfamily.
sat1 protein networkhttps://string-db.org/network/866895.HBHAL_2676Sulfate adenylyltransferase; Belongs to the sulfate adenylyltransferase family.
cysC1 protein networkhttps://string-db.org/network/866895.HBHAL_2677Adenylylsulfate kinase; Catalyzes the synthesis of activated sulfate.
cobA protein networkhttps://string-db.org/network/866895.HBHAL_2678uroporphyrinogen-III C-methyltransferase; Belongs to the precorrin methyltransferase family.
sirB protein networkhttps://string-db.org/network/866895.HBHAL_2679Sirohydrochlorin ferrochelatase.
sirC protein networkhttps://string-db.org/network/866895.HBHAL_2680Precorrin-2 dehydrogenase.
CCG45031.1 protein networkhttps://string-db.org/network/866895.HBHAL_2681Conserved hypothetical protein.
CCG45032.1 protein networkhttps://string-db.org/network/866895.HBHAL_2682Sulfite reductase (NADPH) alpha subunit; Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for t [...]
cysI protein networkhttps://string-db.org/network/866895.HBHAL_2683Sulfite reductase (NADPH) beta subunit; Component of the sulfite reductase complex that catalyzes the 6-electron reduction of sulfite to sulfide. This is one of several activities required for th [...]
yisY protein networkhttps://string-db.org/network/866895.HBHAL_2685AB hydrolase superfamily protein.
CCG45036.1 protein networkhttps://string-db.org/network/866895.HBHAL_26863-hydroxyisobutyrate dehydrogenase.
CCG45037.1 protein networkhttps://string-db.org/network/866895.HBHAL_2687Hypothetical protein.
CCG45038.1 protein networkhttps://string-db.org/network/866895.HBHAL_2688Hypothetical protein.
CCG45039.1 protein networkhttps://string-db.org/network/866895.HBHAL_2689TetR family transcription regulator.
CCG45040.1 protein networkhttps://string-db.org/network/866895.HBHAL_2690ABC-type transport system ATP-binding protein (probable substrate antibiotic).
CCG45041.1 protein networkhttps://string-db.org/network/866895.HBHAL_2691ABC-type transport system permease protein (probable substrate antibiotic).
CCG45042.1 protein networkhttps://string-db.org/network/866895.HBHAL_2692Hypothetical protein.
CCG45043.1 protein networkhttps://string-db.org/network/866895.HBHAL_2693Hypothetical protein.
CCG45044.1 protein networkhttps://string-db.org/network/866895.HBHAL_2694Hypothetical protein.
CCG45045.1 protein networkhttps://string-db.org/network/866895.HBHAL_2695Hypothetical protein.
CCG45046.1 protein networkhttps://string-db.org/network/866895.HBHAL_2696Hypothetical protein.
CCG45047.1 protein networkhttps://string-db.org/network/866895.HBHAL_2697Hypothetical protein.
CCG45048.1 protein networkhttps://string-db.org/network/866895.HBHAL_2698Oxidoreductase, aldo/keto reductase family.
CCG45049.1 protein networkhttps://string-db.org/network/866895.HBHAL_2699Acetyltransferase, GNAT family.
yfkA protein networkhttps://string-db.org/network/866895.HBHAL_2700Conserved hypothetical protein.
CCG45051.1 protein networkhttps://string-db.org/network/866895.HBHAL_2701Hypothetical protein.
CCG45052.1 protein networkhttps://string-db.org/network/866895.HBHAL_2702Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG45053.1 protein networkhttps://string-db.org/network/866895.HBHAL_2703Alpha/beta fold hydrolase.
CCG45054.1 protein networkhttps://string-db.org/network/866895.HBHAL_2704Hypothetical protein.
CCG45055.1 protein networkhttps://string-db.org/network/866895.HBHAL_2705Conserved hypothetical protein.
yflT protein networkhttps://string-db.org/network/866895.HBHAL_2706Hypothetical protein.
fimA protein networkhttps://string-db.org/network/866895.HBHAL_2707Hypothetical protein.
CCG45058.1 protein networkhttps://string-db.org/network/866895.HBHAL_2709IS150-type transposase orfAB.
CCG45059.1 protein networkhttps://string-db.org/network/866895.HBHAL_2710Hypothetical protein.
CCG45060.1 protein networkhttps://string-db.org/network/866895.HBHAL_2711Hypothetical protein.
CCG45061.1 protein networkhttps://string-db.org/network/866895.HBHAL_2712Hypothetical protein.
CCG45062.1 protein networkhttps://string-db.org/network/866895.HBHAL_2713ArsR family transcription regulator.
CCG45063.1 protein networkhttps://string-db.org/network/866895.HBHAL_2714IS1341-type transposase.
CCG45064.1 protein networkhttps://string-db.org/network/866895.HBHAL_2715Putative MFS-type transporter.
fdhD protein networkhttps://string-db.org/network/866895.HBHAL_2716Protein FdhD homolog; Required for formate dehydrogenase (FDH) activity. Acts as a sulfur carrier protein that transfers sulfur from IscS to the molybdenum cofactor prior to its insertion into FD [...]
CCG45066.1 protein networkhttps://string-db.org/network/866895.HBHAL_2717Probable formate dehydrogenase alpha subunit.
CCG45067.1 protein networkhttps://string-db.org/network/866895.HBHAL_2718Hypothetical protein.
CCG45068.1 protein networkhttps://string-db.org/network/866895.HBHAL_2719Hypothetical protein.
CCG45069.1 protein networkhttps://string-db.org/network/866895.HBHAL_2720Hypothetical protein.
CCG45070.1 protein networkhttps://string-db.org/network/866895.HBHAL_2721Conserved hypothetical protein.
CCG45071.1 protein networkhttps://string-db.org/network/866895.HBHAL_2722Probable oxidoreductase.
CCG45072.1 protein networkhttps://string-db.org/network/866895.HBHAL_2723Beta-lactam antibiotic acylase family protein.
CCG45073.1 protein networkhttps://string-db.org/network/866895.HBHAL_2724ThiJ/PfpI domain protein.
CCG45074.1 protein networkhttps://string-db.org/network/866895.HBHAL_2725Antibiotic biosynthesis monooxygenase.
CCG45075.1 protein networkhttps://string-db.org/network/866895.HBHAL_2726Hypothetical protein.
CCG45076.1 protein networkhttps://string-db.org/network/866895.HBHAL_2727Glyceraldehyde-3-phosphate dehydrogenase,NADP-dependent; Belongs to the aldehyde dehydrogenase family.
CCG45077.1 protein networkhttps://string-db.org/network/866895.HBHAL_2728Na+/H+ antiporter family protein.
sir2 protein networkhttps://string-db.org/network/866895.HBHAL_2729NAD-dependent deacetylase.
CCG45079.1 protein networkhttps://string-db.org/network/866895.HBHAL_2730FMN-containing NADPH-linked nitro/flavin reductase; Belongs to the flavin oxidoreductase frp family.
CCG45081.1 protein networkhttps://string-db.org/network/866895.HBHAL_2732Hypothetical protein.
CCG45082.1 protein networkhttps://string-db.org/network/866895.HBHAL_2733ABC-type transport system ATP-binding protein (probable substrate antibiotic).
CCG45083.1 protein networkhttps://string-db.org/network/866895.HBHAL_2734ABC-type transport system permease protein (probable substrate antibiotic).
CCG45084.1 protein networkhttps://string-db.org/network/866895.HBHAL_2735Oxidoreductase.
CCG45085.1 protein networkhttps://string-db.org/network/866895.HBHAL_2736Oxidoreductase domain protein.
yoaR protein networkhttps://string-db.org/network/866895.HBHAL_2737VanW family protein.
CCG45087.1 protein networkhttps://string-db.org/network/866895.HBHAL_2738Hypothetical protein.
yloQ protein networkhttps://string-db.org/network/866895.HBHAL_2740Ribosome-associated GTPase; One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play [...]
glnA2 protein networkhttps://string-db.org/network/866895.HBHAL_2741Glutamine synthetase.
CCG45090.1 protein networkhttps://string-db.org/network/866895.HBHAL_2742Hypothetical protein.
ppaC protein networkhttps://string-db.org/network/866895.HBHAL_2743Putative manganese-dependent inorganic pyrophosphatase.
CCG45092.1 protein networkhttps://string-db.org/network/866895.HBHAL_2744Hypothetical protein.
CCG45093.1 protein networkhttps://string-db.org/network/866895.HBHAL_2745Acetyltransferase, GNAT family.
corA protein networkhttps://string-db.org/network/866895.HBHAL_2746CorA-like magnesium transport protein; Mediates influx of magnesium ions. Belongs to the CorA metal ion transporter (MIT) (TC 1.A.35) family.
CCG45095.1 protein networkhttps://string-db.org/network/866895.HBHAL_2747Thioredoxin reductase-like protein.
CCG45096.1 protein networkhttps://string-db.org/network/866895.HBHAL_2748Hypothetical protein.
CCG45097.1 protein networkhttps://string-db.org/network/866895.HBHAL_2749Short-chain dehydrogenase/reductase family protein.
yueE protein networkhttps://string-db.org/network/866895.HBHAL_2750Hypothetical protein.
CCG45099.1 protein networkhttps://string-db.org/network/866895.HBHAL_2751Hypothetical protein.
CCG45100.1 protein networkhttps://string-db.org/network/866895.HBHAL_2752Hypothetical protein.
moeA protein networkhttps://string-db.org/network/866895.HBHAL_2753Molybdopterin biosynthesis protein; Catalyzes the insertion of molybdate into adenylated molybdopterin with the concomitant release of AMP. Belongs to the MoeA family.
moaA protein networkhttps://string-db.org/network/866895.HBHAL_2754Molybdenum cofactor biosynthesis protein A; Catalyzes the cyclization of GTP to (8S)-3',8-cyclo-7,8- dihydroguanosine 5'-triphosphate.
CCG45103.1 protein networkhttps://string-db.org/network/866895.HBHAL_2755IS110-type transposase.
CCG45104.1 protein networkhttps://string-db.org/network/866895.HBHAL_2756Alcohol dehydrogenase.
CCG45105.1 protein networkhttps://string-db.org/network/866895.HBHAL_2757Conserved hypothetical protein.
CCG45106.1 protein networkhttps://string-db.org/network/866895.HBHAL_2758Cation transporter family protein.
crtNa protein networkhttps://string-db.org/network/866895.HBHAL_2760Apo-8'-phytoene desaturase.
crtNc protein networkhttps://string-db.org/network/866895.HBHAL_2761Probable apo-8'-phytoene desaturase/dehydrogenase.
crtM protein networkhttps://string-db.org/network/866895.HBHAL_2762Apo-8'-phytoene synthase.
crtNb protein networkhttps://string-db.org/network/866895.HBHAL_2763Probable apo-8'-phytoene desaturase/dehydrogenase.
CCG45112.1 protein networkhttps://string-db.org/network/866895.HBHAL_2764Probable hydroxy-3,4-dehydro-apo-8'-lycopene glucosyltransferase.
CCG45113.1 protein networkhttps://string-db.org/network/866895.HBHAL_2765Phospholipid/glycerol acyltransferase.
CCG45114.1 protein networkhttps://string-db.org/network/866895.HBHAL_2766Conserved hypothetical protein.
CCG45115.1 protein networkhttps://string-db.org/network/866895.HBHAL_2767Conserved hypothetical protein.
CCG45116.1 protein networkhttps://string-db.org/network/866895.HBHAL_2768Hypothetical protein.
CCG45117.1 protein networkhttps://string-db.org/network/866895.HBHAL_2769Hypothetical protein.
CCG45118.1 protein networkhttps://string-db.org/network/866895.HBHAL_2770IS231-type transposase.
CCG45119.1 protein networkhttps://string-db.org/network/866895.HBHAL_2771Hypothetical protein.
sipT1 protein networkhttps://string-db.org/network/866895.HBHAL_2772Signal peptidase I; Belongs to the peptidase S26 family.
CCG45121.1 protein networkhttps://string-db.org/network/866895.HBHAL_2773Hypothetical protein.
CCG45122.1 protein networkhttps://string-db.org/network/866895.HBHAL_2774Aminotransferase.
CCG45123.1 protein networkhttps://string-db.org/network/866895.HBHAL_2775Hypothetical protein.
CCG45125.1 protein networkhttps://string-db.org/network/866895.HBHAL_2777Conserved hypothetical protein.
CCG45126.1 protein networkhttps://string-db.org/network/866895.HBHAL_2778Hypothetical protein.
CCG45127.1 protein networkhttps://string-db.org/network/866895.HBHAL_2779Hypothetical protein.
cheV protein networkhttps://string-db.org/network/866895.HBHAL_2780Chemotaxis protein CheV.
CCG45129.1 protein networkhttps://string-db.org/network/866895.HBHAL_2781Hypothetical protein.
ykyB protein networkhttps://string-db.org/network/866895.HBHAL_2782Hypothetical protein.
sco1 protein networkhttps://string-db.org/network/866895.HBHAL_2783Cytochrome c oxidase assembly protein Sco.
CCG45132.1 protein networkhttps://string-db.org/network/866895.HBHAL_2784Conserved hypothetical protein.
CCG45133.1 protein networkhttps://string-db.org/network/866895.HBHAL_2785Short-chain dehydrogenase/reductase family protein.
CCG45134.1 protein networkhttps://string-db.org/network/866895.HBHAL_2786Hemolysin III family protein.
CCG45135.1 protein networkhttps://string-db.org/network/866895.HBHAL_2787CBS domain protein.
CCG45137.1 protein networkhttps://string-db.org/network/866895.HBHAL_2789MFS-type transporter (probable function drug resistance).
dapH protein networkhttps://string-db.org/network/866895.HBHAL_2790Tetrahydrodipicolinate N-acetyltransferase; Catalyzes the transfer of an acetyl group from acetyl-CoA to tetrahydrodipicolinate.
CCG45139.1 protein networkhttps://string-db.org/network/866895.HBHAL_2791N-acetyldiaminopimelate deacetylase; Catalyzes the conversion of N-acetyl-diaminopimelate to diaminopimelate and acetate.
CCG45140.1 protein networkhttps://string-db.org/network/866895.HBHAL_2792UPF0180 family protein; Belongs to the UPF0180 family.
CCG45141.1 protein networkhttps://string-db.org/network/866895.HBHAL_2793DUF21/CBS domain protein.
CCG45142.1 protein networkhttps://string-db.org/network/866895.HBHAL_2794Small-conductance mechanosensitive channel.
ykuU protein networkhttps://string-db.org/network/866895.HBHAL_27952-cys peroxiredoxin.
ykuV protein networkhttps://string-db.org/network/866895.HBHAL_2796Thiol-disulfide oxidoreductase YkuV.
CCG45145.1 protein networkhttps://string-db.org/network/866895.HBHAL_2797ABC-type transport system ATP-binding/permease protein.
CCG45146.1 protein networkhttps://string-db.org/network/866895.HBHAL_2798ABC-type transport system ATP-binding/permease protein.
cydA protein networkhttps://string-db.org/network/866895.HBHAL_2799Cytochrome d ubiquinol oxidase subunit I.
cydB protein networkhttps://string-db.org/network/866895.HBHAL_2800Cytochrome d ubiquinol oxidase subunit II.
CCG45149.1 protein networkhttps://string-db.org/network/866895.HBHAL_2801Potassium uptake protein.
ydaP protein networkhttps://string-db.org/network/866895.HBHAL_2802Pyruvate oxidase; Belongs to the TPP enzyme family.
rnjA protein networkhttps://string-db.org/network/866895.HBHAL_2803Ribonuclease J; An RNase that has 5'-3' exonuclease and possibly endonuclease activity. Involved in maturation of rRNA and in some organisms also mRNA maturation and/or decay; Belongs to the meta [...]
ykzG protein networkhttps://string-db.org/network/866895.HBHAL_2804Hypothetical protein; Belongs to the UPF0356 family.
ykrA protein networkhttps://string-db.org/network/866895.HBHAL_2805HAD superfamily hydrolase.
def protein networkhttps://string-db.org/network/866895.HBHAL_2806Peptide deformylase; Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a [...]
ykyA protein networkhttps://string-db.org/network/866895.HBHAL_2807Hypothetical protein.
pdhA2 protein networkhttps://string-db.org/network/866895.HBHAL_2808Pyruvate dehydrogenase subunit E1-alpha; The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2). It contains multiple copies of three enzymatic co [...]
pdhB2 protein networkhttps://string-db.org/network/866895.HBHAL_2809Pyruvate dehydrogenase subunit E1-beta.
CCG45158.1 protein networkhttps://string-db.org/network/866895.HBHAL_2810Dihydrolipoyllysine-residue acetyltransferase.
CCG45159.1 protein networkhttps://string-db.org/network/866895.HBHAL_2811Dihydrolipoamide dehydrogenase.
CCG45160.1 protein networkhttps://string-db.org/network/866895.HBHAL_2812Hypothetical protein.
CCG45161.1 protein networkhttps://string-db.org/network/866895.HBHAL_2813Hypothetical protein.
CCG45163.1 protein networkhttps://string-db.org/network/866895.HBHAL_2815BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family.
CCG45164.1 protein networkhttps://string-db.org/network/866895.HBHAL_2816UPF0421 family protein.
CCG45165.1 protein networkhttps://string-db.org/network/866895.HBHAL_2817Polysaccharide deacetylase.
CCG45166.1 protein networkhttps://string-db.org/network/866895.HBHAL_2818Arginine decarboxylase.
CCG45167.1 protein networkhttps://string-db.org/network/866895.HBHAL_2819Homolog to 2-nitropropane dioxygenase.
yktA protein networkhttps://string-db.org/network/866895.HBHAL_2820Hypothetical protein; Belongs to the UPF0223 family.
yktB protein networkhttps://string-db.org/network/866895.HBHAL_2821Hypothetical protein; Belongs to the UPF0637 family.
CCG45170.1 protein networkhttps://string-db.org/network/866895.HBHAL_2822Hypothetical protein.
suhB protein networkhttps://string-db.org/network/866895.HBHAL_2823Inositol-phosphate phosphatase.
CCG45172.1 protein networkhttps://string-db.org/network/866895.HBHAL_2824Hypothetical protein.
CCG45173.1 protein networkhttps://string-db.org/network/866895.HBHAL_2825Hypothetical protein.
CCG45174.1 protein networkhttps://string-db.org/network/866895.HBHAL_2826Hypothetical protein.
CCG45175.1 protein networkhttps://string-db.org/network/866895.HBHAL_2827Conserved hypothetical protein.
CCG45176.1 protein networkhttps://string-db.org/network/866895.HBHAL_2828Hypothetical protein.
glsA2 protein networkhttps://string-db.org/network/866895.HBHAL_2829Glutaminase; Belongs to the glutaminase family.
ylaN protein networkhttps://string-db.org/network/866895.HBHAL_2830Hypothetical protein; Belongs to the UPF0358 family.
ftsW protein networkhttps://string-db.org/network/866895.HBHAL_2831Cell-division protein; Belongs to the SEDS family.
pyc protein networkhttps://string-db.org/network/866895.HBHAL_2832Pyruvate carboxylase; Catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate [...]
ctaB protein networkhttps://string-db.org/network/866895.HBHAL_2834Protoheme IX farnesyltransferase; Converts heme B (protoheme IX) to heme O by substitution of the vinyl group on carbon 2 of heme B porphyrin ring with a hydroxyethyl farnesyl side group; Belongs [...]
ctaC protein networkhttps://string-db.org/network/866895.HBHAL_2835Cytochrome c oxidase subunit II; Subunits I and II form the functional core of the enzyme complex. Electrons originating in cytochrome c are transferred via heme a and Cu(A) to the binuclear cent [...]
ctaD protein networkhttps://string-db.org/network/866895.HBHAL_2836Cytochrome c oxidase subunit I; Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Subunits 1-3 form the functional core of the enzyme [...]
ctaE protein networkhttps://string-db.org/network/866895.HBHAL_2837Cytochrome c oxidase subunit III.
ctaF protein networkhttps://string-db.org/network/866895.HBHAL_2838Cytochrome c oxidase subunit IV.
ctaG protein networkhttps://string-db.org/network/866895.HBHAL_2839Cytochrome c oxidase assembly protein CtaG.
CCG45188.1 protein networkhttps://string-db.org/network/866895.HBHAL_2840Conserved hypothetical protein.
CCG45189.1 protein networkhttps://string-db.org/network/866895.HBHAL_2841Acetyltransferase, GNAT family.
CCG45190.1 protein networkhttps://string-db.org/network/866895.HBHAL_2842UPF0118 family protein.
CCG45191.1 protein networkhttps://string-db.org/network/866895.HBHAL_2843Hypothetical protein.
CCG45192.1 protein networkhttps://string-db.org/network/866895.HBHAL_2844Hypothetical protein.
CCG45193.1 protein networkhttps://string-db.org/network/866895.HBHAL_2845Hypothetical protein.
CCG45194.1 protein networkhttps://string-db.org/network/866895.HBHAL_2846Hypothetical protein.
CCG45195.1 protein networkhttps://string-db.org/network/866895.HBHAL_2847Hypothetical protein.
ylbF protein networkhttps://string-db.org/network/866895.HBHAL_2848Hypothetical protein; Belongs to the UPF0342 family.
CCG45197.1 protein networkhttps://string-db.org/network/866895.HBHAL_2849Conserved hypothetical protein.
CCG45198.1 protein networkhttps://string-db.org/network/866895.HBHAL_2850UPF0298 family protein.
CCG45199.1 protein networkhttps://string-db.org/network/866895.HBHAL_2851Conserved hypothetical protein.
CCG45200.1 protein networkhttps://string-db.org/network/866895.HBHAL_2852Putative methyltransferase.
coaD protein networkhttps://string-db.org/network/866895.HBHAL_2853Phosphopantetheine adenylyltransferase; Reversibly transfers an adenylyl group from ATP to 4'- phosphopantetheine, yielding dephospho-CoA (dPCoA) and pyrophosphate. Belongs to the bacterial CoaD [...]
CCG45202.1 protein networkhttps://string-db.org/network/866895.HBHAL_2854Conserved hypothetical protein.
ylbK protein networkhttps://string-db.org/network/866895.HBHAL_2855NTE family protein.
ylbL protein networkhttps://string-db.org/network/866895.HBHAL_2856Conserved hypothetical protein.
ylbM protein networkhttps://string-db.org/network/866895.HBHAL_2857Hypothetical protein; Catalyzes the formation of N(4)-acetylcytidine (ac(4)C) at the wobble position of elongator tRNA(Met), using acetate and ATP as substrates. First activates an acetate ion to [...]
CCG45206.1 protein networkhttps://string-db.org/network/866895.HBHAL_2858Hypothetical protein.
CCG45207.1 protein networkhttps://string-db.org/network/866895.HBHAL_2859Conserved hypothetical protein.
rpmF protein networkhttps://string-db.org/network/866895.HBHAL_286050S ribosomal protein L32; Belongs to the bacterial ribosomal protein bL32 family.
CCG45209.1 protein networkhttps://string-db.org/network/866895.HBHAL_2861enoyl-CoA hydratase / 3-hydroxybutyryl-CoA dehydratase; Belongs to the enoyl-CoA hydratase/isomerase family.
CCG45210.1 protein networkhttps://string-db.org/network/866895.HBHAL_2862RsfA family transcription regulator.
ylbP protein networkhttps://string-db.org/network/866895.HBHAL_2863Hypothetical protein.
CCG45212.1 protein networkhttps://string-db.org/network/866895.HBHAL_28642-dehydropantoate 2-reductase; Catalyzes the NADPH-dependent reduction of ketopantoate into pantoic acid.
CCG45213.1 protein networkhttps://string-db.org/network/866895.HBHAL_2865Hypothetical protein.
bshC protein networkhttps://string-db.org/network/866895.HBHAL_2866Hypothetical protein; Involved in bacillithiol (BSH) biosynthesis. May catalyze the last step of the pathway, the addition of cysteine to glucosamine malate (GlcN-Mal) to generate BSH.
mraZ protein networkhttps://string-db.org/network/866895.HBHAL_2867MraZ protein; Belongs to the MraZ family.
rsmH protein networkhttps://string-db.org/network/866895.HBHAL_2868S-adenosyl-methyltransferase; Specifically methylates the N4 position of cytidine in position 1402 (C1402) of 16S rRNA.
ftsL protein networkhttps://string-db.org/network/866895.HBHAL_2869Hypothetical protein; Essential cell division protein; Belongs to the FtsL family.
CCG45218.1 protein networkhttps://string-db.org/network/866895.HBHAL_2870Penicillin binding protein 2B.
CCG45219.1 protein networkhttps://string-db.org/network/866895.HBHAL_2871Stage V sporulation protein D (sporulation-specific penicillin binding protein).
murE protein networkhttps://string-db.org/network/866895.HBHAL_2872UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2, 6-diaminopimelate ligase; Catalyzes the addition of meso-diaminopimelic acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (U [...]
murF protein networkhttps://string-db.org/network/866895.HBHAL_2873UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D- alanine ligase; Involved in cell wall formation. Catalyzes the final step in the synthesis of UDP-N-acetylmuramoyl-pentapeptide, the precursor of mure [...]
mraY protein networkhttps://string-db.org/network/866895.HBHAL_2874phospho-N-acetylmuramoyl-pentapeptide- transferase; First step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan; Belongs to the glycosyltransferase 4 family. MraY s [...]
murD protein networkhttps://string-db.org/network/866895.HBHAL_2875UDP-N-acetylmuramoylalanine--D-glutamate ligase; Cell wall formation. Catalyzes the addition of glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanine (UMA). Belongs to the MurCDEF [...]
CCG45224.1 protein networkhttps://string-db.org/network/866895.HBHAL_2876Stage V sporulation protein E; Belongs to the SEDS family.
divIB protein networkhttps://string-db.org/network/866895.HBHAL_2877Cell-division initiation protein; Cell division protein that may be involved in stabilizing or promoting the assembly of the division complex; Belongs to the FtsQ/DivIB family. DivIB subfamily.
ftsA protein networkhttps://string-db.org/network/866895.HBHAL_2878Cell division protein FtsA; Cell division protein that is involved in the assembly of the Z ring. May serve as a membrane anchor for the Z ring. Belongs to the FtsA/MreB family.
ftsZ protein networkhttps://string-db.org/network/866895.HBHAL_2879Cell division protein FtsZ; Essential cell division protein that forms a contractile ring structure (Z ring) at the future cell division site. The regulation of the ring assembly controls the tim [...]
CCG45228.1 protein networkhttps://string-db.org/network/866895.HBHAL_2880Sporulation sigma-E factor processing peptidase (stage II sporulation protein GA); Probable aspartic protease that is responsible for the proteolytic cleavage of the RNA polymerase sigma E factor [...]
sigE protein networkhttps://string-db.org/network/866895.HBHAL_2881RNA polymerase sigma factor SigE; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.
sigG protein networkhttps://string-db.org/network/866895.HBHAL_2882RNA polymerase sigma factor SigG; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.
CCG45232.1 protein networkhttps://string-db.org/network/866895.HBHAL_2884Conserved hypothetical protein.
ylmD protein networkhttps://string-db.org/network/866895.HBHAL_2885Conserved hypothetical protein; Belongs to the multicopper oxidase YfiH/RL5 family.
ylmE protein networkhttps://string-db.org/network/866895.HBHAL_2886UPF0001 family protein; Pyridoxal 5'-phosphate (PLP)-binding protein, which is involved in PLP homeostasis; Belongs to the pyridoxal phosphate-binding protein YggS/PROSC family.
sepF protein networkhttps://string-db.org/network/866895.HBHAL_2887Putative cell division protein SepF; Cell division protein that is part of the divisome complex and is recruited early to the Z-ring. Probably stimulates Z-ring formation, perhaps through the cro [...]
CCG45236.1 protein networkhttps://string-db.org/network/866895.HBHAL_2888Conserved hypothetical protein.
CCG45237.1 protein networkhttps://string-db.org/network/866895.HBHAL_2889Conserved hypothetical protein.
CCG45238.1 protein networkhttps://string-db.org/network/866895.HBHAL_2890Cell division initiation protein.
CCG45239.1 protein networkhttps://string-db.org/network/866895.HBHAL_2891Hypothetical protein.
lspA protein networkhttps://string-db.org/network/866895.HBHAL_2892Lipoprotein signal peptidase; This protein specifically catalyzes the removal of signal peptides from prolipoproteins; Belongs to the peptidase A8 family.
rluD3 protein networkhttps://string-db.org/network/866895.HBHAL_2893Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family.
pyrR protein networkhttps://string-db.org/network/866895.HBHAL_2894Pyrimidine regulatory protein PyrR; Also displays a weak uracil phosphoribosyltransferase activity which is not physiologically significant; Belongs to the purine/pyrimidine phosphoribosyltransfe [...]
pyrP protein networkhttps://string-db.org/network/866895.HBHAL_2895Uracil permease.
pyrB protein networkhttps://string-db.org/network/866895.HBHAL_2896Aspartate carbamoyltransferase catalytic subunit; Belongs to the aspartate/ornithine carbamoyltransferase superfamily. ATCase family.
pyrC protein networkhttps://string-db.org/network/866895.HBHAL_2897Dihydroorotase; Catalyzes the reversible cyclization of carbamoyl aspartate to dihydroorotate; Belongs to the metallo-dependent hydrolases superfamily. DHOase family. Class I DHOase subfamily.
carA1 protein networkhttps://string-db.org/network/866895.HBHAL_2898Carbamoyl phosphate synthase small subunit; Belongs to the CarA family.
carB1 protein networkhttps://string-db.org/network/866895.HBHAL_2899Carbamoyl phosphate synthase large subunit; Belongs to the CarB family.
pyrK protein networkhttps://string-db.org/network/866895.HBHAL_2900Dihydroorotate dehydrogenase (NAD+) electron transfer subunit; Responsible for channeling the electrons from the oxidation of dihydroorotate from the FMN redox center in the PyrD type B subunit t [...]
pyrD protein networkhttps://string-db.org/network/866895.HBHAL_2901Dihydroorotate dehydrogenase (NAD+) catalytic subunit; Catalyzes the conversion of dihydroorotate to orotate.
pyrF protein networkhttps://string-db.org/network/866895.HBHAL_2902Orotidine 5'-phosphate decarboxylase; Catalyzes the decarboxylation of orotidine 5'-monophosphate (OMP) to uridine 5'-monophosphate (UMP); Belongs to the OMP decarboxylase family. Type 1 subfamil [...]
pyrE protein networkhttps://string-db.org/network/866895.HBHAL_2903Orotate phosphoribosyltransferase; Catalyzes the transfer of a ribosyl phosphate group from 5- phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).
CCG45252.1 protein networkhttps://string-db.org/network/866895.HBHAL_2904Hypothetical protein.
CCG45253.1 protein networkhttps://string-db.org/network/866895.HBHAL_2905Fibronectin/fibrinogen-binding protein, putative.
CCG45254.1 protein networkhttps://string-db.org/network/866895.HBHAL_2906Hypothetical protein.
CCG45255.1 protein networkhttps://string-db.org/network/866895.HBHAL_2907Conserved hypothetical protein; Belongs to the RemA family.
gmk protein networkhttps://string-db.org/network/866895.HBHAL_2908Guanylate kinase; Essential for recycling GMP and indirectly, cGMP.
rpoZ protein networkhttps://string-db.org/network/866895.HBHAL_2909DNA-directed RNA polymerase omega subunit; Promotes RNA polymerase assembly. Latches the N- and C- terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alp [...]
CCG45258.1 protein networkhttps://string-db.org/network/866895.HBHAL_2910Pantothenate metabolism; Catalyzes two steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4- phosphopantothenoylcysteine, in the l [...]
priA protein networkhttps://string-db.org/network/866895.HBHAL_2911Primosome assembly protein PriA; Involved in the restart of stalled replication forks. Recognizes and binds the arrested nascent DNA chain at stalled replication forks. It can open the DNA duplex [...]
fmt protein networkhttps://string-db.org/network/866895.HBHAL_2912methionyl-tRNA formyltransferase; Attaches a formyl group to the free amino group of methionyl- tRNA(fMet). The formyl group appears to play a dual role in the initiator identity of N-formylmethi [...]
CCG45261.1 protein networkhttps://string-db.org/network/866895.HBHAL_2913Sun protein; Specifically methylates the cytosine at position 967 (m5C967) of 16S rRNA.
prpC protein networkhttps://string-db.org/network/866895.HBHAL_2914Protein phosphatase 2C.
prkC protein networkhttps://string-db.org/network/866895.HBHAL_2915Serine/threonine protein kinase PrkC.
rsgA protein networkhttps://string-db.org/network/866895.HBHAL_2916Ribosome-associated GTPase; One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Helps release RbfA from mature subunits. May play [...]
rpe protein networkhttps://string-db.org/network/866895.HBHAL_2917Ribulose-phosphate 3-epimerase; Belongs to the ribulose-phosphate 3-epimerase family.
thiN protein networkhttps://string-db.org/network/866895.HBHAL_2918Thiamine pyrophosphokinase.
rpmB protein networkhttps://string-db.org/network/866895.HBHAL_291950S ribosomal protein L28; Belongs to the bacterial ribosomal protein bL28 family.
CCG45268.1 protein networkhttps://string-db.org/network/866895.HBHAL_2920Conserved hypothetical protein.
CCG45269.1 protein networkhttps://string-db.org/network/866895.HBHAL_2921Conserved hypothetical protein.
rsbR4 protein networkhttps://string-db.org/network/866895.HBHAL_2922RsbR family protein.
CCG45271.1 protein networkhttps://string-db.org/network/866895.HBHAL_2923MFS-type transporter; Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family.
CCG45272.1 protein networkhttps://string-db.org/network/866895.HBHAL_2924Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG45273.1 protein networkhttps://string-db.org/network/866895.HBHAL_2925Hypothetical protein.
CCG45274.1 protein networkhttps://string-db.org/network/866895.HBHAL_2926Heat shock protein Hsp20; Belongs to the small heat shock protein (HSP20) family.
yozB protein networkhttps://string-db.org/network/866895.HBHAL_2927Conserved hypothetical protein.
CCG45276.1 protein networkhttps://string-db.org/network/866895.HBHAL_2928Hypothetical protein.
uvsE2 protein networkhttps://string-db.org/network/866895.HBHAL_2929UV damage endonuclease.
rlmN protein networkhttps://string-db.org/network/866895.HBHAL_293023S rRNA (adenine-C2)-methyltransferase RlmN; Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs; Belongs to the radical SAM superfamily. RlmN fa [...]
CCG45279.1 protein networkhttps://string-db.org/network/866895.HBHAL_2931Hypothetical protein.
uspA4 protein networkhttps://string-db.org/network/866895.HBHAL_2932UspA domain protein.
CCG45281.1 protein networkhttps://string-db.org/network/866895.HBHAL_2933LacI family transcription regulator.
CCG45282.1 protein networkhttps://string-db.org/network/866895.HBHAL_2934ABC-type transport system extracellular binding protein (probable substrate sugar).
yvgZ protein networkhttps://string-db.org/network/866895.HBHAL_2935Hypothetical protein.
CCG45284.1 protein networkhttps://string-db.org/network/866895.HBHAL_2936Heavy metal-transporting P-type ATPase.
CCG45285.1 protein networkhttps://string-db.org/network/866895.HBHAL_2937Hypothetical protein.
copB protein networkhttps://string-db.org/network/866895.HBHAL_2938Heavy metal translocating P-type ATPase.
CCG45287.1 protein networkhttps://string-db.org/network/866895.HBHAL_2939Hypothetical protein.
pphA protein networkhttps://string-db.org/network/866895.HBHAL_2940Serine/threonine protein phosphatase.
guaC protein networkhttps://string-db.org/network/866895.HBHAL_2941GMP reductase; Catalyzes the irreversible NADPH-dependent deamination of GMP to IMP. It functions in the conversion of nucleobase, nucleoside and nucleotide derivatives of G to A nucleotides, and [...]
CCG45290.1 protein networkhttps://string-db.org/network/866895.HBHAL_2942Diguanylate phosphodiesterase domain protein.
CCG45291.1 protein networkhttps://string-db.org/network/866895.HBHAL_2943NADH:flavin oxidoreductase.
CCG45292.1 protein networkhttps://string-db.org/network/866895.HBHAL_2944Ferredoxin; Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
CCG45293.1 protein networkhttps://string-db.org/network/866895.HBHAL_2945Pirin-like protein; Belongs to the pirin family.
CCG45294.1 protein networkhttps://string-db.org/network/866895.HBHAL_2946MarR family transcription regulator.
CCG45295.1 protein networkhttps://string-db.org/network/866895.HBHAL_2947Hypothetical protein.
CCG45296.1 protein networkhttps://string-db.org/network/866895.HBHAL_2948SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
CCG45298.1 protein networkhttps://string-db.org/network/866895.HBHAL_2950ABC-type transport system extracellular binding protein (probable substrate iron complex).
CCG45299.1 protein networkhttps://string-db.org/network/866895.HBHAL_2951ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.
CCG45300.1 protein networkhttps://string-db.org/network/866895.HBHAL_2952ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.
CCG45301.1 protein networkhttps://string-db.org/network/866895.HBHAL_2953Hypothetical protein.
CCG45302.1 protein networkhttps://string-db.org/network/866895.HBHAL_2954Hypothetical protein.
CCG45303.1 protein networkhttps://string-db.org/network/866895.HBHAL_2955Conserved hypothetical protein.
rsbR2 protein networkhttps://string-db.org/network/866895.HBHAL_2956RsbR family protein.
yuaG protein networkhttps://string-db.org/network/866895.HBHAL_2957Conserved hypothetical protein.
CCG45306.1 protein networkhttps://string-db.org/network/866895.HBHAL_2958Hypothetical protein.
CCG45307.1 protein networkhttps://string-db.org/network/866895.HBHAL_2959Conserved hypothetical protein.
CCG45308.1 protein networkhttps://string-db.org/network/866895.HBHAL_2960Hypothetical protein.
pulA protein networkhttps://string-db.org/network/866895.HBHAL_2962Pullulanase; Belongs to the glycosyl hydrolase 13 family.
CCG45311.1 protein networkhttps://string-db.org/network/866895.HBHAL_2963LacI family transcription regulator.
sspH-2 protein networkhttps://string-db.org/network/866895.HBHAL_2964Acid-soluble spore protein; Belongs to the SspH family.
CCG45313.1 protein networkhttps://string-db.org/network/866895.HBHAL_2965Hypothetical protein.
CCG45315.1 protein networkhttps://string-db.org/network/866895.HBHAL_2967Hypothetical protein.
CCG45316.1 protein networkhttps://string-db.org/network/866895.HBHAL_2968Hypothetical protein.
CCG45317.1 protein networkhttps://string-db.org/network/866895.HBHAL_2969ISL3-type transposase.
pflA protein networkhttps://string-db.org/network/866895.HBHAL_2970Pyruvate formate-lyase-activating enzyme; Activation of pyruvate formate-lyase under anaerobic conditions by generation of an organic free radical, using S- adenosylmethionine and reduced flavodo [...]
CCG45319.1 protein networkhttps://string-db.org/network/866895.HBHAL_2971Alcohol dehydrogenase.
CCG45320.1 protein networkhttps://string-db.org/network/866895.HBHAL_2972Formate acetyltransferase.
CCG45321.1 protein networkhttps://string-db.org/network/866895.HBHAL_2974Hypothetical protein.
CCG45322.1 protein networkhttps://string-db.org/network/866895.HBHAL_2975Short-chain dehydrogenase/reductase family protein.
CCG45323.1 protein networkhttps://string-db.org/network/866895.HBHAL_2976Hypothetical protein.
CCG45324.1 protein networkhttps://string-db.org/network/866895.HBHAL_2977Conserved hypothetical protein.
CCG45325.1 protein networkhttps://string-db.org/network/866895.HBHAL_2978Hypothetical protein.
CCG45326.1 protein networkhttps://string-db.org/network/866895.HBHAL_2979Hypothetical protein.
CCG45327.1 protein networkhttps://string-db.org/network/866895.HBHAL_2980TetR family transcription regulator.
CCG45328.1 protein networkhttps://string-db.org/network/866895.HBHAL_2981Putative MFS-type transporter; Belongs to the major facilitator superfamily.
CCG45329.1 protein networkhttps://string-db.org/network/866895.HBHAL_2982acyl-CoA carboxylase alpha subunit.
CCG45330.1 protein networkhttps://string-db.org/network/866895.HBHAL_2983long-chain-fatty-acid--CoA ligase.
CCG45331.1 protein networkhttps://string-db.org/network/866895.HBHAL_2984Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
CCG45332.1 protein networkhttps://string-db.org/network/866895.HBHAL_2985SET domain protein.
CCG45333.1 protein networkhttps://string-db.org/network/866895.HBHAL_2986Hypothetical protein.
CCG45335.1 protein networkhttps://string-db.org/network/866895.HBHAL_2988Hypothetical protein.
CCG45336.1 protein networkhttps://string-db.org/network/866895.HBHAL_2989Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG45337.1 protein networkhttps://string-db.org/network/866895.HBHAL_2990Putative carboxymuconolactone decarboxylase.
murE-3 protein networkhttps://string-db.org/network/866895.HBHAL_2992UDP-N-acetylmuramyl-tripeptide synthetase; Catalyzes the addition of an amino acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (UMAG) in the biosynthesis of bacterial ce [...]
cpdB protein networkhttps://string-db.org/network/866895.HBHAL_29932',3'-cyclic nucleotide 2'-phosphodiesterase.
CCG45341.1 protein networkhttps://string-db.org/network/866895.HBHAL_2994MFS-type transporter (probable function xanthine/uracil permease).
CCG45342.1 protein networkhttps://string-db.org/network/866895.HBHAL_2995L-serine dehydratase beta subunit; Belongs to the iron-sulfur dependent L-serine dehydratase family.
CCG45343.1 protein networkhttps://string-db.org/network/866895.HBHAL_2996L-serine dehydratase alpha subunit; Belongs to the iron-sulfur dependent L-serine dehydratase family.
recG protein networkhttps://string-db.org/network/866895.HBHAL_2997ATP-dependent DNA helicase RecG; Critical role in recombination and DNA repair. Helps process Holliday junction intermediates to mature products by catalyzing branch migration. Has a DNA unwindin [...]
ykfA protein networkhttps://string-db.org/network/866895.HBHAL_2998S66 family peptidase.
fapR protein networkhttps://string-db.org/network/866895.HBHAL_2999Transcription regulator FapR; Transcriptional factor involved in regulation of membrane lipid biosynthesis by repressing genes involved in fatty acid and phospholipid metabolism.
plsX protein networkhttps://string-db.org/network/866895.HBHAL_3000Fatty acid/phospholipid synthesis protein; Catalyzes the reversible formation of acyl-phosphate (acyl- PO(4)) from acyl-[acyl-carrier-protein] (acyl-ACP). This enzyme utilizes acyl-ACP as fatty a [...]
fabD protein networkhttps://string-db.org/network/866895.HBHAL_3001Acyl-carrier-protein S-malonyltransferase.
CCG45349.1 protein networkhttps://string-db.org/network/866895.HBHAL_30023-oxoacyl-[acyl-carrier-protein] reductase; Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cy [...]
acpP protein networkhttps://string-db.org/network/866895.HBHAL_3003Acyl carrier protein; Carrier of the growing fatty acid chain in fatty acid biosynthesis.
rnc protein networkhttps://string-db.org/network/866895.HBHAL_3004Ribonuclease III; Digests double-stranded RNA. Involved in the processing of primary rRNA transcript to yield the immediate precursors to the large and small rRNAs (23S and 16S). Processes some m [...]
CCG45352.1 protein networkhttps://string-db.org/network/866895.HBHAL_3005Hypothetical protein.
smc protein networkhttps://string-db.org/network/866895.HBHAL_3006Chromosome partition protein Smc; Required for chromosome condensation and partitioning. Belongs to the SMC family.
ftsY protein networkhttps://string-db.org/network/866895.HBHAL_3007Signal recognition particle-docking protein FtsY; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Acts as a receptor for the complex formed by the [...]
CCG45355.1 protein networkhttps://string-db.org/network/866895.HBHAL_3008UPF0122 family protein; Might take part in the signal recognition particle (SRP) pathway. This is inferred from the conservation of its genetic proximity to ftsY/ffh. May be a regulatory protein.
ffh protein networkhttps://string-db.org/network/866895.HBHAL_3009Signal recognition particle protein; Involved in targeting and insertion of nascent membrane proteins into the cytoplasmic membrane. Binds to the hydrophobic signal sequence of the ribosome-nasce [...]
rpsP protein networkhttps://string-db.org/network/866895.HBHAL_301030S ribosomal protein S16; Belongs to the bacterial ribosomal protein bS16 family.
ylqC protein networkhttps://string-db.org/network/866895.HBHAL_3011UPF0109 family protein; Belongs to the UPF0109 family.
ylqD protein networkhttps://string-db.org/network/866895.HBHAL_3012Hypothetical protein.
rimM protein networkhttps://string-db.org/network/866895.HBHAL_301316S rRNA processing protein RimM; An accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19 [...]
trmD protein networkhttps://string-db.org/network/866895.HBHAL_3014tRNA (guanine-N(1)-)-methyltransferase; Specifically methylates guanosine-37 in various tRNAs. Belongs to the RNA methyltransferase TrmD family.
rplS protein networkhttps://string-db.org/network/866895.HBHAL_301550S ribosomal protein L19; This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site.
sipT2 protein networkhttps://string-db.org/network/866895.HBHAL_3016Signal peptidase I; Belongs to the peptidase S26 family.
ylqF protein networkhttps://string-db.org/network/866895.HBHAL_3017Ribosomal biogenesis GTPase; Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity; Belongs to the TRAFAC class YlqF/YawG GTPase family. MTG1 subfamily.
rnhB protein networkhttps://string-db.org/network/866895.HBHAL_3018Ribonuclease HII; Endonuclease that specifically degrades the RNA of RNA-DNA hybrids.
ylqG protein networkhttps://string-db.org/network/866895.HBHAL_3019Hypothetical protein.
ylqH protein networkhttps://string-db.org/network/866895.HBHAL_3020Flagellar biosynthesis protein.
sucC protein networkhttps://string-db.org/network/866895.HBHAL_3021succinyl-CoA synthetase beta subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus repr [...]
sucD protein networkhttps://string-db.org/network/866895.HBHAL_3022succinyl-CoA synthetase alpha subunit; Succinyl-CoA synthetase functions in the citric acid cycle (TCA), coupling the hydrolysis of succinyl-CoA to the synthesis of either ATP or GTP and thus rep [...]
smf protein networkhttps://string-db.org/network/866895.HBHAL_3023Smf family DNA processing protein.
topA protein networkhttps://string-db.org/network/866895.HBHAL_3024DNA topoisomerase I; Releases the supercoiling and torsional tension of DNA, which is introduced during the DNA replication and transcription, by transiently cleaving and rejoining one strand of [...]
xerC protein networkhttps://string-db.org/network/866895.HBHAL_3025Site-specific tyrosine recombinase XerC; Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC- XerD complex is essenti [...]
clpQ protein networkhttps://string-db.org/network/866895.HBHAL_3026ATP-dependent protease peptidase subunit; Protease subunit of a proteasome-like degradation complex believed to be a general protein degrading machinery.
hslU protein networkhttps://string-db.org/network/866895.HBHAL_3027ATP-dependent protease ATP-binding subunit; ATPase subunit of a proteasome-like degradation complex; this subunit has chaperone activity. The binding of ATP and its subsequent hydrolysis by HslU [...]
codY protein networkhttps://string-db.org/network/866895.HBHAL_3028GTP-sensing pleiotropic transcription repressor CodY; DNA-binding protein that represses the expression of many genes that are induced as cells make the transition from rapid exponential growth t [...]
flgB protein networkhttps://string-db.org/network/866895.HBHAL_3029Flagellar basal body rod protein; Structural component of flagellum, the bacterial motility apparatus. Part of the rod structure of flagellar basal body.
flgC protein networkhttps://string-db.org/network/866895.HBHAL_3030Flagellar basal body rod protein; Belongs to the flagella basal body rod proteins family.
fliE protein networkhttps://string-db.org/network/866895.HBHAL_3031Flagellar hook-basal body protein.
fliF protein networkhttps://string-db.org/network/866895.HBHAL_3032Flagellar MS-ring protein; The M ring may be actively involved in energy transduction. Belongs to the FliF family.
fliG protein networkhttps://string-db.org/network/866895.HBHAL_3033Flagellar motor switch protein.
fliH protein networkhttps://string-db.org/network/866895.HBHAL_3034Flagellar assembly protein.
fliI protein networkhttps://string-db.org/network/866895.HBHAL_3035Flagellar export ATPase.
fliJ protein networkhttps://string-db.org/network/866895.HBHAL_3036Flagellar biosynthesis chaperone.
CCG45384.1 protein networkhttps://string-db.org/network/866895.HBHAL_3037Hypothetical protein.
CCG45385.1 protein networkhttps://string-db.org/network/866895.HBHAL_3038Homolog to flagellar hook-length control protein.
flgD protein networkhttps://string-db.org/network/866895.HBHAL_3039Flagellar hook assembly protein.
CCG45387.1 protein networkhttps://string-db.org/network/866895.HBHAL_3040Conserved hypothetical protein.
flgG protein networkhttps://string-db.org/network/866895.HBHAL_3041Flagellar hook-basal body protein.
CCG45389.1 protein networkhttps://string-db.org/network/866895.HBHAL_3042Hypothetical protein.
fliL protein networkhttps://string-db.org/network/866895.HBHAL_3043Flagellar protein FliL.
fliM protein networkhttps://string-db.org/network/866895.HBHAL_3044Flagellar motor switch protein.
fliY protein networkhttps://string-db.org/network/866895.HBHAL_3045Flagellar motor switch protein.
cheY protein networkhttps://string-db.org/network/866895.HBHAL_3046Chemotaxis protein CheY.
fliZ protein networkhttps://string-db.org/network/866895.HBHAL_3047Flagellar biosynthetic protein FliZ.
fliP protein networkhttps://string-db.org/network/866895.HBHAL_3048Flagellar biosynthesis protein; Plays a role in the flagellum-specific transport system. Belongs to the FliP/MopC/SpaP family.
fliQ protein networkhttps://string-db.org/network/866895.HBHAL_3049Flagellar biosynthesis protein; Role in flagellar biosynthesis. Belongs to the FliQ/MopD/SpaQ family.
fliR protein networkhttps://string-db.org/network/866895.HBHAL_3050Flagellar biosynthesis protein; Role in flagellar biosynthesis. Belongs to the FliR/MopE/SpaR family.
flhB protein networkhttps://string-db.org/network/866895.HBHAL_3051Flagellar biosynthesis protein; Required for formation of the rod structure in the basal body of the flagellar apparatus. Together with FliI and FliH, may constitute the export apparatus of flage [...]
flhA protein networkhttps://string-db.org/network/866895.HBHAL_3052Flagellar biosynthesis protein; Required for formation of the rod structure of the flagellar apparatus. Together with FliI and FliH, may constitute the export apparatus of flagellin; Belongs to t [...]
flhF protein networkhttps://string-db.org/network/866895.HBHAL_3053Flagellar biosynthesis regulator.
flhG protein networkhttps://string-db.org/network/866895.HBHAL_3054Flagellar biosynthesis protein.
CCG45402.1 protein networkhttps://string-db.org/network/866895.HBHAL_3055Hypothetical protein.
cheA protein networkhttps://string-db.org/network/866895.HBHAL_3056Chemotaxis protein CheA.
cheW protein networkhttps://string-db.org/network/866895.HBHAL_3057Chemotaxis protein CheW.
CCG45405.1 protein networkhttps://string-db.org/network/866895.HBHAL_3058Chemotactic methyltransferase inhibitor.
cheD protein networkhttps://string-db.org/network/866895.HBHAL_3059Chemoreceptor glutamine deamidase; Probably deamidates glutamine residues to glutamate on methyl-accepting chemotaxis receptors (MCPs), playing an important role in chemotaxis; Belongs to the Che [...]
sigD protein networkhttps://string-db.org/network/866895.HBHAL_3060RNA polymerase sigma factor SigD; Belongs to the sigma-70 factor family.
CCG45408.1 protein networkhttps://string-db.org/network/866895.HBHAL_3061Hypothetical protein.
CCG45409.1 protein networkhttps://string-db.org/network/866895.HBHAL_3062Hypothetical protein.
ylxL protein networkhttps://string-db.org/network/866895.HBHAL_3063Hypothetical protein.
rpsB protein networkhttps://string-db.org/network/866895.HBHAL_306430S ribosomal protein S2; Belongs to the universal ribosomal protein uS2 family.
tsf protein networkhttps://string-db.org/network/866895.HBHAL_3065Translation elongation factor Ts; Associates with the EF-Tu.GDP complex and induces the exchange of GDP to GTP. It remains bound to the aminoacyl-tRNA.EF- Tu.GTP complex up to the GTP hydrolysis [...]
pyrH1 protein networkhttps://string-db.org/network/866895.HBHAL_3066Uridylate kinase; Catalyzes the reversible phosphorylation of UMP to UDP.
frr protein networkhttps://string-db.org/network/866895.HBHAL_3067Ribosome recycling factor; Responsible for the release of ribosomes from messenger RNA at the termination of protein biosynthesis. May increase the efficiency of translation by recycling ribosome [...]
uppS protein networkhttps://string-db.org/network/866895.HBHAL_3068Undecaprenyl pyrophosphate synthase; Catalyzes the condensation of isopentenyl diphosphate (IPP) with allylic pyrophosphates generating different type of terpenoids.
cdsA protein networkhttps://string-db.org/network/866895.HBHAL_3069Phosphatidate cytidylyltransferase; Belongs to the CDS family.
dxr protein networkhttps://string-db.org/network/866895.HBHAL_30701-deoxy-D-xylulose 5-phosphate reductoisomerase; Catalyzes the NADP-dependent rearrangement and reduction of 1-deoxy-D-xylulose-5-phosphate (DXP) to 2-C-methyl-D-erythritol 4- phosphate (MEP); Be [...]
CCG45418.1 protein networkhttps://string-db.org/network/866895.HBHAL_3071Putative membrane-associated zinc metalloprotease.
proS protein networkhttps://string-db.org/network/866895.HBHAL_3072prolyl-tRNA synthetase; Catalyzes the attachment of proline to tRNA(Pro) in a two- step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRN [...]
polC protein networkhttps://string-db.org/network/866895.HBHAL_3073DNA polymerase III (gram-positive type); Required for replicative DNA synthesis. This DNA polymerase also exhibits 3' to 5' exonuclease activity.
ylxS protein networkhttps://string-db.org/network/866895.HBHAL_3074Conserved hypothetical protein; Required for maturation of 30S ribosomal subunits. Belongs to the RimP family.
nusA protein networkhttps://string-db.org/network/866895.HBHAL_3075Transcription elongation factor NusA; Participates in both transcription termination and antitermination.
CCG45423.1 protein networkhttps://string-db.org/network/866895.HBHAL_3076Conserved hypothetical protein.
ylxQ protein networkhttps://string-db.org/network/866895.HBHAL_3077Hypothetical protein.
infB protein networkhttps://string-db.org/network/866895.HBHAL_3078Translation initiation factor IF-2; One of the essential components for the initiation of protein synthesis. Protects formylmethionyl-tRNA from spontaneous hydrolysis and promotes its binding to [...]
ylxP protein networkhttps://string-db.org/network/866895.HBHAL_3079Hypothetical protein.
rbfA protein networkhttps://string-db.org/network/866895.HBHAL_3080Ribosome-binding factor A; One of several proteins that assist in the late maturation steps of the functional core of the 30S ribosomal subunit. Associates with free 30S ribosomal subunits (but n [...]
truB protein networkhttps://string-db.org/network/866895.HBHAL_3081tRNA pseudouridine 55 synthase; Responsible for synthesis of pseudouridine from uracil-55 in the psi GC loop of transfer RNAs; Belongs to the pseudouridine synthase TruB family. Type 1 subfamily.
CCG45429.1 protein networkhttps://string-db.org/network/866895.HBHAL_3082Riboflavin biosynthesis protein; Belongs to the ribF family.
rpsO protein networkhttps://string-db.org/network/866895.HBHAL_308330S ribosomal protein S15; Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome.
pnpA protein networkhttps://string-db.org/network/866895.HBHAL_3084Polyribonucleotide nucleotidyltransferase; Involved in mRNA degradation. Catalyzes the phosphorolysis of single-stranded polyribonucleotides processively in the 3'- to 5'- direction.
CCG45432.1 protein networkhttps://string-db.org/network/866895.HBHAL_3085Probable sporulation protein, polysaccharide deacetylase family.
CCG45433.1 protein networkhttps://string-db.org/network/866895.HBHAL_3086Conserved hypothetical protein.
spoVFA protein networkhttps://string-db.org/network/866895.HBHAL_3087Dipicolinate synthase subunit A.
CCG45435.1 protein networkhttps://string-db.org/network/866895.HBHAL_3088Dipicolinate synthase subunit B.
asd protein networkhttps://string-db.org/network/866895.HBHAL_3089Aspartate-semialdehyde dehydrogenase; Catalyzes the NADPH-dependent formation of L-aspartate- semialdehyde (L-ASA) by the reductive dephosphorylation of L-aspartyl- 4-phosphate; Belongs to the as [...]
dapG1 protein networkhttps://string-db.org/network/866895.HBHAL_3090Aspartate kinase; Belongs to the aspartokinase family.
dapA2 protein networkhttps://string-db.org/network/866895.HBHAL_3091Dihydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA).
tepA protein networkhttps://string-db.org/network/866895.HBHAL_3093Hypothetical protein.
CCG45441.1 protein networkhttps://string-db.org/network/866895.HBHAL_3094Hypothetical protein.
ftsK protein networkhttps://string-db.org/network/866895.HBHAL_3095DNA translocase FtsK; Belongs to the FtsK/SpoIIIE/SftA family.
CCG45443.1 protein networkhttps://string-db.org/network/866895.HBHAL_3096GntR family transcription regulator.
yufN protein networkhttps://string-db.org/network/866895.HBHAL_3097Bmp domain protein.
CCG45445.1 protein networkhttps://string-db.org/network/866895.HBHAL_3098ABC-type transport system ATP-binding protein (probable substrate sugar).
CCG45446.1 protein networkhttps://string-db.org/network/866895.HBHAL_3099ABC-type transport system permease protein (probable substrate sugar); Belongs to the binding-protein-dependent transport system permease family.
CCG45447.1 protein networkhttps://string-db.org/network/866895.HBHAL_3100ABC-type transport system permease protein (probable substrate sugar); Belongs to the binding-protein-dependent transport system permease family.
CCG45448.1 protein networkhttps://string-db.org/network/866895.HBHAL_3101M16 family peptidase.
CCG45449.1 protein networkhttps://string-db.org/network/866895.HBHAL_3102Zinc protease, insulinase family.
CCG45450.1 protein networkhttps://string-db.org/network/866895.HBHAL_3103Short-chain dehydrogenase/reductase family protein.
ymfJ protein networkhttps://string-db.org/network/866895.HBHAL_3104Hypothetical protein.
CCG45452.1 protein networkhttps://string-db.org/network/866895.HBHAL_3105Conserved hypothetical protein.
ymfM protein networkhttps://string-db.org/network/866895.HBHAL_3106Hypothetical protein.
pgsA protein networkhttps://string-db.org/network/866895.HBHAL_3108CDP-diacylglycerol--glycerol-3-phosphate3- phosphatidyltransferase; Belongs to the CDP-alcohol phosphatidyltransferase class-I family.
cinA protein networkhttps://string-db.org/network/866895.HBHAL_3109Putative competence damage-inducible protein; Belongs to the CinA family.
recA protein networkhttps://string-db.org/network/866895.HBHAL_3110Recombination protein RecA; Can catalyze the hydrolysis of ATP in the presence of single- stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybrid [...]
rny protein networkhttps://string-db.org/network/866895.HBHAL_3111Ribonuclease Y; Endoribonuclease that initiates mRNA decay.
CCG45459.1 protein networkhttps://string-db.org/network/866895.HBHAL_3112Conserved hypothetical protein.
CCG45460.1 protein networkhttps://string-db.org/network/866895.HBHAL_3113Stage V sporulation protein S.
tdh protein networkhttps://string-db.org/network/866895.HBHAL_3114L-threonine 3-dehydrogenase; Catalyzes the NAD(+)-dependent oxidation of L-threonine to 2- amino-3-ketobutyrate; Belongs to the zinc-containing alcohol dehydrogenase family.
CCG45462.1 protein networkhttps://string-db.org/network/866895.HBHAL_3115Pyridoxal phosphate-dependent acyltransferase; Catalyzes the decarboxylative condensation of pimeloyl-[acyl- carrier protein] and L-alanine to produce 8-amino-7-oxononanoate (AON), [acyl-carrier [...]
miaB protein networkhttps://string-db.org/network/866895.HBHAL_3116tRNA-i(6)A37 thiotransferase enzyme MiaB; Catalyzes the methylthiolation of N6-(dimethylallyl)adenosine (i(6)A), leading to the formation of 2-methylthio-N6- (dimethylallyl)adenosine (ms(2)i(6)A) [...]
ymcA protein networkhttps://string-db.org/network/866895.HBHAL_3117Hypothetical protein; Belongs to the UPF0342 family.
CCG45465.1 protein networkhttps://string-db.org/network/866895.HBHAL_3118Spore coat protein.
mutS1 protein networkhttps://string-db.org/network/866895.HBHAL_3119DNA mismatch repair protein MutS; This protein is involved in the repair of mismatches in DNA. It is possible that it carries out the mismatch recognition step. This protein has a weak ATPase act [...]
mutL protein networkhttps://string-db.org/network/866895.HBHAL_3120DNA mismatch repair protein MutL; This protein is involved in the repair of mismatches in DNA. It is required for dam-dependent methyl-directed DNA mismatch repair. May act as a 'molecular matchm [...]
CCG45468.1 protein networkhttps://string-db.org/network/866895.HBHAL_3121SinR/xre family transcription regulator.
miaA protein networkhttps://string-db.org/network/866895.HBHAL_3122tRNA dimethylallyltransferase; Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(di [...]
hfq protein networkhttps://string-db.org/network/866895.HBHAL_3123RNA-binding protein Hfq; RNA chaperone that binds small regulatory RNA (sRNAs) and mRNAs to facilitate mRNA translational regulation in response to envelope stress, environmental stress and chang [...]
CCG45471.1 protein networkhttps://string-db.org/network/866895.HBHAL_3124Stage V sporulation protein K.
hflX protein networkhttps://string-db.org/network/866895.HBHAL_3125GTPase HflX; GTPase that associates with the 50S ribosomal subunit and may have a role during protein synthesis or ribosome biogenesis. Belongs to the TRAFAC class OBG-HflX-like GTPase superfamil [...]
ynbB protein networkhttps://string-db.org/network/866895.HBHAL_3126Hypothetical protein.
glnR protein networkhttps://string-db.org/network/866895.HBHAL_3127Transcription regulator GlnR.
glnA1 protein networkhttps://string-db.org/network/866895.HBHAL_3128Glutamine synthetase.
CCG45478.1 protein networkhttps://string-db.org/network/866895.HBHAL_3131ISL3-type transposase.
lexA protein networkhttps://string-db.org/network/866895.HBHAL_3132LexA repressor; Represses a number of genes involved in the response to DNA damage (SOS response), including recA and lexA. In the presence of single-stranded DNA, RecA interacts with LexA causin [...]
CCG45480.1 protein networkhttps://string-db.org/network/866895.HBHAL_3133Hypothetical protein.
CCG45481.1 protein networkhttps://string-db.org/network/866895.HBHAL_3134Site-specific recombinase, resolvase family.
ynzC protein networkhttps://string-db.org/network/866895.HBHAL_3135UPF0291 protein.
tkt protein networkhttps://string-db.org/network/866895.HBHAL_3136Transketolase; Catalyzes the transfer of a two-carbon ketol group from a ketose donor to an aldose acceptor, via a covalent intermediate with the cofactor thiamine pyrophosphate.
yneF protein networkhttps://string-db.org/network/866895.HBHAL_3137Conserved hypothetical protein.
ccdA2 protein networkhttps://string-db.org/network/866895.HBHAL_3138Cytochrome c-type biogenesis protein CcdA.
CCG45486.1 protein networkhttps://string-db.org/network/866895.HBHAL_3139Multicomponent Na+/H+ antiporter familiy protein subunit B.
ccdC protein networkhttps://string-db.org/network/866895.HBHAL_3142Locus_tag: HBHAL_3140; product: probable two-component response regulator (nonfunctional); gene has an in-frame stop codon; conceptual translation after in silico reconstruction: MARILVVDDAKFTRLT [...]
CCG45489.1 protein networkhttps://string-db.org/network/866895.HBHAL_3143Hypothetical protein.
acnA protein networkhttps://string-db.org/network/866895.HBHAL_3144Aconitate hydratase; Catalyzes the isomerization of citrate to isocitrate via cis- aconitate.
CCG45491.1 protein networkhttps://string-db.org/network/866895.HBHAL_3145AhpC/TSA family protein.
CCG45492.1 protein networkhttps://string-db.org/network/866895.HBHAL_3146Hypothetical protein.
CCG45493.1 protein networkhttps://string-db.org/network/866895.HBHAL_3147IS1341-type transposase.
tlp protein networkhttps://string-db.org/network/866895.HBHAL_3149Small acid-soluble spore protein; Belongs to the Tlp family.
CCG45495.1 protein networkhttps://string-db.org/network/866895.HBHAL_3150Stage V sporulation protein K.
yneP protein networkhttps://string-db.org/network/866895.HBHAL_3151Conserved hypothetical protein.
yneQ protein networkhttps://string-db.org/network/866895.HBHAL_3152Hypothetical protein.
yneR protein networkhttps://string-db.org/network/866895.HBHAL_3153Hypothetical protein.
CCG45499.1 protein networkhttps://string-db.org/network/866895.HBHAL_3154Conserved hypothetical protein; Could be involved in insertion of integral membrane proteins into the membrane; Belongs to the UPF0161 family.
yciA protein networkhttps://string-db.org/network/866895.HBHAL_3155Conserved hypothetical protein; Converts GTP to 7,8-dihydroneopterin triphosphate.
yneS protein networkhttps://string-db.org/network/866895.HBHAL_3156Hypothetical protein; Catalyzes the transfer of an acyl group from acyl-phosphate (acyl-PO(4)) to glycerol-3-phosphate (G3P) to form lysophosphatidic acid (LPA). This enzyme utilizes acyl-phospha [...]
opuBA protein networkhttps://string-db.org/network/866895.HBHAL_3157ABC-type transport system ATP-binding protein (probable substrate osmoprotectant).
opuBBC protein networkhttps://string-db.org/network/866895.HBHAL_3158ABC-type transport system permease/substrate-binding protein (probable substrate osmoprotectant).
CCG45504.1 protein networkhttps://string-db.org/network/866895.HBHAL_3159CoA binding domain family protein.
parE protein networkhttps://string-db.org/network/866895.HBHAL_3160DNA topoisomerase IV subunit B; Topoisomerase IV is essential for chromosome segregation. It relaxes supercoiled DNA. Performs the decatenation events required during the replication of a circula [...]
parC protein networkhttps://string-db.org/network/866895.HBHAL_3161DNA topoisomerase IV subunit A; Topoisomerase IV is essential for chromosome segregation. It relaxes supercoiled DNA. Performs the decatenation events required during the replication of a circula [...]
CCG45507.1 protein networkhttps://string-db.org/network/866895.HBHAL_3162TetR family transcription regulator.
CCG45508.1 protein networkhttps://string-db.org/network/866895.HBHAL_3163acyl-CoA dehydrogenase.
CCG45509.1 protein networkhttps://string-db.org/network/866895.HBHAL_3164long-chain-fatty-acid--CoA ligase.
yngH protein networkhttps://string-db.org/network/866895.HBHAL_3165Biotin carboxylase.
CCG45511.1 protein networkhttps://string-db.org/network/866895.HBHAL_3166Biotin/lipoyl attachment domain protein.
yngG protein networkhttps://string-db.org/network/866895.HBHAL_3167hydroxymethylglutaryl-CoA lyase.
CCG45513.1 protein networkhttps://string-db.org/network/866895.HBHAL_3168enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family.
CCG45514.1 protein networkhttps://string-db.org/network/866895.HBHAL_3169propionyl-CoA carboxylase.
acs protein networkhttps://string-db.org/network/866895.HBHAL_3170acetoacetyl-CoA synthase, putative.
sqdB protein networkhttps://string-db.org/network/866895.HBHAL_3171Sulfolipid biosynthesis protein.
CCG45517.1 protein networkhttps://string-db.org/network/866895.HBHAL_3172Group 1 glycosyltransferase.
ywmF protein networkhttps://string-db.org/network/866895.HBHAL_3174Conserved hypothetical protein.
aadK protein networkhttps://string-db.org/network/866895.HBHAL_3175Aminoglycoside 6-adenylyltransferase.
CCG45521.1 protein networkhttps://string-db.org/network/866895.HBHAL_3176Hypothetical protein.
CCG45522.1 protein networkhttps://string-db.org/network/866895.HBHAL_3177DNA polymerase III epsilon subunit.
CCG45523.1 protein networkhttps://string-db.org/network/866895.HBHAL_3178Nitroreductase family protein.
CCG45524.1 protein networkhttps://string-db.org/network/866895.HBHAL_3179Acetyltransferase, GNAT family.
yycE protein networkhttps://string-db.org/network/866895.HBHAL_3180Glyoxalase domain protein.
CCG45526.1 protein networkhttps://string-db.org/network/866895.HBHAL_3181ABC-type transport system extracellular binding protein (probable substrate iron complex).
CCG45527.1 protein networkhttps://string-db.org/network/866895.HBHAL_3182Methionine sulfoxide reductase.
CCG45528.1 protein networkhttps://string-db.org/network/866895.HBHAL_3183Hypothetical protein.
yitL protein networkhttps://string-db.org/network/866895.HBHAL_3184Conserved hypothetical protein; Belongs to the CvfB family.
CCG45530.1 protein networkhttps://string-db.org/network/866895.HBHAL_3185Hypothetical protein.
yceB protein networkhttps://string-db.org/network/866895.HBHAL_3186Luciferase family oxidoreductase.
CCG45532.1 protein networkhttps://string-db.org/network/866895.HBHAL_3187Hypothetical protein.
CCG45533.1 protein networkhttps://string-db.org/network/866895.HBHAL_3188Alcohol dehydrogenase.
yocH1 protein networkhttps://string-db.org/network/866895.HBHAL_3189Conserved hypothetical protein.
CCG45535.1 protein networkhttps://string-db.org/network/866895.HBHAL_3190ABC-type transport system ATP-binding protein.
CCG45536.1 protein networkhttps://string-db.org/network/866895.HBHAL_3191Conserved hypothetical protein.
CCG45537.1 protein networkhttps://string-db.org/network/866895.HBHAL_3192Hypothetical protein.
CCG45538.1 protein networkhttps://string-db.org/network/866895.HBHAL_3193Cold shock protein.
sodC2 protein networkhttps://string-db.org/network/866895.HBHAL_3194Superoxide dismutase (Cu/Zn).
CCG45540.1 protein networkhttps://string-db.org/network/866895.HBHAL_3195Hypothetical protein.
CCG45541.1 protein networkhttps://string-db.org/network/866895.HBHAL_3196C45 family peptidase.
CCG45542.1 protein networkhttps://string-db.org/network/866895.HBHAL_3197Alpha/beta fold hydrolase.
ykqA protein networkhttps://string-db.org/network/866895.HBHAL_3198Hypothetical protein.
CCG45544.1 protein networkhttps://string-db.org/network/866895.HBHAL_3199S58/DmpA family peptidase.
yflL protein networkhttps://string-db.org/network/866895.HBHAL_3200Acylphosphatase.
CCG45546.1 protein networkhttps://string-db.org/network/866895.HBHAL_3201Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG45547.1 protein networkhttps://string-db.org/network/866895.HBHAL_3202Ferredoxin; Ferredoxins are iron-sulfur proteins that transfer electrons in a wide variety of metabolic reactions.
CCG45548.1 protein networkhttps://string-db.org/network/866895.HBHAL_3203Phosphoglycerate mutase family protein.
CCG45549.1 protein networkhttps://string-db.org/network/866895.HBHAL_3204Probable metal-dependent hydrolase.
yozC protein networkhttps://string-db.org/network/866895.HBHAL_3205Hypothetical protein.
mhqD protein networkhttps://string-db.org/network/866895.HBHAL_3206Probable hydrolase MhqD.
yhjN protein networkhttps://string-db.org/network/866895.HBHAL_3207Conserved hypothetical protein.
ykwB protein networkhttps://string-db.org/network/866895.HBHAL_3208Hypothetical protein.
CCG45554.1 protein networkhttps://string-db.org/network/866895.HBHAL_3209TetR family transcription regulator.
msrB protein networkhttps://string-db.org/network/866895.HBHAL_3210Peptide methionine sulfoxide reductase; Has an important function as a repair enzyme for proteins that have been inactivated by oxidation. Catalyzes the reversible oxidation-reduction of methioni [...]
CCG45556.1 protein networkhttps://string-db.org/network/866895.HBHAL_3211Hypothetical protein.
ung protein networkhttps://string-db.org/network/866895.HBHAL_3212uracil-DNA glycosylase; Excises uracil residues from the DNA which can arise as a result of misincorporation of dUMP residues by DNA polymerase or due to deamination of cytosine.
ytmB protein networkhttps://string-db.org/network/866895.HBHAL_3213Hypothetical protein.
sbcC protein networkhttps://string-db.org/network/866895.HBHAL_3214Exonuclease SbcC.
sbcD protein networkhttps://string-db.org/network/866895.HBHAL_3215Exonuclease SbcD; SbcCD cleaves DNA hairpin structures. These structures can inhibit DNA replication and are intermediates in certain DNA recombination reactions. The complex acts as a 3'->5' dou [...]
CCG45561.1 protein networkhttps://string-db.org/network/866895.HBHAL_3216UPF0346 family protein; Belongs to the UPF0346 family.
tatC protein networkhttps://string-db.org/network/866895.HBHAL_3217Sec-independent protein translocase protein TatC; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...]
tatA1 protein networkhttps://string-db.org/network/866895.HBHAL_3218Sec-independent protein translocase protein TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...]
tatA2 protein networkhttps://string-db.org/network/866895.HBHAL_3219Sec-independent protein translocase protein TatA; Part of the twin-arginine translocation (Tat) system that transports large folded proteins containing a characteristic twin- arginine motif in th [...]
mobA protein networkhttps://string-db.org/network/866895.HBHAL_3220Molybdopterin-guanine dinucleotide biosynthesis protein MobA; Transfers a GMP moiety from GTP to Mo-molybdopterin (Mo-MPT) cofactor (Moco or molybdenum cofactor) to form Mo-molybdopterin guanine [...]
CCG45566.1 protein networkhttps://string-db.org/network/866895.HBHAL_3221Dihydrofolate reductase; Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.
thyA protein networkhttps://string-db.org/network/866895.HBHAL_3222Thymidylate synthase; Catalyzes the reductive methylation of 2'-deoxyuridine-5'- monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate ( [...]
CCG45568.1 protein networkhttps://string-db.org/network/866895.HBHAL_3223Conserved hypothetical protein.
yunF protein networkhttps://string-db.org/network/866895.HBHAL_3224Hypothetical protein.
fhs protein networkhttps://string-db.org/network/866895.HBHAL_3225Formate--tetrahydrofolate ligase; Belongs to the formate--tetrahydrofolate ligase family.
CCG45571.1 protein networkhttps://string-db.org/network/866895.HBHAL_3226Hypothetical protein.
CCG45572.1 protein networkhttps://string-db.org/network/866895.HBHAL_3227Cold shock protein.
ypdP protein networkhttps://string-db.org/network/866895.HBHAL_3228Conserved hypothetical protein; Involved in the import of queuosine (Q) precursors, required for Q precursor salvage; Belongs to the vitamin uptake transporter (VUT/ECF) (TC 2.A.88) family. Q pre [...]
rnhA protein networkhttps://string-db.org/network/866895.HBHAL_3229Ribonuclease H.
CCG45575.1 protein networkhttps://string-db.org/network/866895.HBHAL_3230Hypothetical protein.
CCG45576.1 protein networkhttps://string-db.org/network/866895.HBHAL_3231Hypothetical protein.
CCG45577.1 protein networkhttps://string-db.org/network/866895.HBHAL_3231_AConserved hypothetical protein.
bcsA protein networkhttps://string-db.org/network/866895.HBHAL_3232Naringenin-chalcone synthase.
CCG45579.1 protein networkhttps://string-db.org/network/866895.HBHAL_3233Short-chain dehydrogenase/reductase family protein.
CCG45580.1 protein networkhttps://string-db.org/network/866895.HBHAL_3234Hypothetical protein.
ypwA protein networkhttps://string-db.org/network/866895.HBHAL_3235Thermostable carboxypeptidase 1; Broad specificity carboxypetidase that releases amino acids sequentially from the C-terminus, including neutral, aromatic, polar and basic residues.
CCG45582.1 protein networkhttps://string-db.org/network/866895.HBHAL_3236Conserved hypothetical protein; Belongs to the methyltransferase superfamily.
gpsB protein networkhttps://string-db.org/network/866895.HBHAL_3237Cell cycle protein GpsB; Divisome component that associates with the complex late in its assembly, after the Z-ring is formed, and is dependent on DivIC and PBP2B for its recruitment to the divis [...]
CCG45584.1 protein networkhttps://string-db.org/network/866895.HBHAL_3238UPF0398 family protein; Belongs to the UPF0398 family.
CCG45585.1 protein networkhttps://string-db.org/network/866895.HBHAL_3239Hypothetical protein.
cdd protein networkhttps://string-db.org/network/866895.HBHAL_3241Cytidine deaminase; This enzyme scavenges exogenous and endogenous cytidine and 2'-deoxycytidine for UMP synthesis; Belongs to the cytidine and deoxycytidylate deaminase family.
CCG45587.1 protein networkhttps://string-db.org/network/866895.HBHAL_3242Acriflavin resistance protein family transporter; Belongs to the resistance-nodulation-cell division (RND) (TC 2.A.6) family.
CCG45588.1 protein networkhttps://string-db.org/network/866895.HBHAL_3243Hypothetical protein.
CCG45589.1 protein networkhttps://string-db.org/network/866895.HBHAL_3244Hypothetical protein.
CCG45590.1 protein networkhttps://string-db.org/network/866895.HBHAL_3245Hypothetical protein.
recU protein networkhttps://string-db.org/network/866895.HBHAL_3246Holliday junction-specific endonuclease; Endonuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves mobile four-strand junctions by introducing symmetrical nicks [...]
ponA protein networkhttps://string-db.org/network/866895.HBHAL_3247Penicillin-binding proteins 1A/1B.
nth protein networkhttps://string-db.org/network/866895.HBHAL_3248Endonuclease III; DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N- [...]
dnaD protein networkhttps://string-db.org/network/866895.HBHAL_3249DNA replication protein DnaD.
asnS protein networkhttps://string-db.org/network/866895.HBHAL_3250asparaginyl-tRNA synthetase.
CCG45596.1 protein networkhttps://string-db.org/network/866895.HBHAL_3251Aspartate aminotransferase.
CCG45597.1 protein networkhttps://string-db.org/network/866895.HBHAL_3252Hypothetical protein.
ypmA protein networkhttps://string-db.org/network/866895.HBHAL_3253Conserved hypothetical protein.
dinG protein networkhttps://string-db.org/network/866895.HBHAL_3254Bifunctional ATP-dependent DNA helicase DinG / DnaQ family exonuclease; 3'-5' exonuclease.
panD protein networkhttps://string-db.org/network/866895.HBHAL_3255Aspartate 1-decarboxylase; Catalyzes the pyruvoyl-dependent decarboxylation of aspartate to produce beta-alanine.
panC protein networkhttps://string-db.org/network/866895.HBHAL_3256Pantoate-beta-alanine ligase; Catalyzes the condensation of pantoate with beta-alanine in an ATP-dependent reaction via a pantoyl-adenylate intermediate. Belongs to the pantothenate synthetase fa [...]
panB protein networkhttps://string-db.org/network/866895.HBHAL_32573-methyl-2-oxobutanoatehydroxymethyltransferase; Catalyzes the reversible reaction in which hydroxymethyl group from 5,10-methylenetetrahydrofolate is transferred onto alpha- ketoisovalerate to f [...]
birA protein networkhttps://string-db.org/network/866895.HBHAL_3257_ABiotin [acetyl-CoA carboxylase] ligase; Acts both as a biotin--[acetyl-CoA-carboxylase] ligase and a repressor; Belongs to the biotin--protein ligase family.
cca protein networkhttps://string-db.org/network/866895.HBHAL_3258CCA-adding enzyme.
CCG45605.1 protein networkhttps://string-db.org/network/866895.HBHAL_3259Group 1 glycosyltransferase.
mgsA protein networkhttps://string-db.org/network/866895.HBHAL_3260Methylglyoxal synthase; Catalyzes the formation of methylglyoxal from dihydroxyacetone phosphate.
dapB protein networkhttps://string-db.org/network/866895.HBHAL_3261Dihydrodipicolinate reductase; Catalyzes the conversion of 4-hydroxy-tetrahydrodipicolinate (HTPA) to tetrahydrodipicolinate; Belongs to the DapB family.
ypjD protein networkhttps://string-db.org/network/866895.HBHAL_3262Hypothetical protein.
CCG45609.1 protein networkhttps://string-db.org/network/866895.HBHAL_3263Conserved hypothetical protein.
CCG45610.1 protein networkhttps://string-db.org/network/866895.HBHAL_3264Conserved hypothetical protein.
CCG45611.1 protein networkhttps://string-db.org/network/866895.HBHAL_3265Hypothetical protein.
CCG45612.1 protein networkhttps://string-db.org/network/866895.HBHAL_3266Conserved hypothetical protein.
qcrC protein networkhttps://string-db.org/network/866895.HBHAL_3267Menaquinol-cytochrome c reductase cytochrome b/c subunit.
qcrB protein networkhttps://string-db.org/network/866895.HBHAL_3268Menaquinol-cytochrome c reductase cytochrome b subunit.
qcrA protein networkhttps://string-db.org/network/866895.HBHAL_3269Menaquinol-cytochrome c reductase iron-sulfur subunit.
ypiF protein networkhttps://string-db.org/network/866895.HBHAL_3270Hypothetical protein.
ypiB protein networkhttps://string-db.org/network/866895.HBHAL_3271Hypothetical protein; Belongs to the UPF0302 family.
ypiA protein networkhttps://string-db.org/network/866895.HBHAL_3272Hypothetical protein.
CCG45619.1 protein networkhttps://string-db.org/network/866895.HBHAL_3273Hypothetical protein.
aroA protein networkhttps://string-db.org/network/866895.HBHAL_32743-phosphoshikimate 1-carboxyvinyltransferase; Catalyzes the transfer of the enolpyruvyl moiety of phosphoenolpyruvate (PEP) to the 5-hydroxyl of shikimate-3-phosphate (S3P) to produce enolpyruvyl [...]
tyrA protein networkhttps://string-db.org/network/866895.HBHAL_3275Prephenate dehydrogenase.
hisC-2 protein networkhttps://string-db.org/network/866895.HBHAL_3276Histidinol-phosphate aminotransferase; Belongs to the class-II pyridoxal-phosphate-dependent aminotransferase family. Histidinol-phosphate aminotransferase subfamily.
aroH protein networkhttps://string-db.org/network/866895.HBHAL_3277Chorismate mutase; Catalyzes the Claisen rearrangement of chorismate to prephenate. Probably involved in the aromatic amino acid biosynthesis.
aroB protein networkhttps://string-db.org/network/866895.HBHAL_32783-dehydroquinate synthase; Catalyzes the conversion of 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) to dehydroquinate (DHQ).
aroF protein networkhttps://string-db.org/network/866895.HBHAL_3279Chorismate synthase; Catalyzes the anti-1,4-elimination of the C-3 phosphate and the C-6 proR hydrogen from 5-enolpyruvylshikimate-3-phosphate (EPSP) to yield chorismate, which is the branch poin [...]
cheR protein networkhttps://string-db.org/network/866895.HBHAL_3280Chemotaxis protein methyltransferase.
ndk protein networkhttps://string-db.org/network/866895.HBHAL_3281Nucleoside diphosphate kinase; Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, [...]
hepT protein networkhttps://string-db.org/network/866895.HBHAL_3282Heptaprenyl diphosphate synthase component II; Belongs to the FPP/GGPP synthase family.
menG protein networkhttps://string-db.org/network/866895.HBHAL_3283Ubiquinone/menaquinone biosynthesis methyltransferase; Methyltransferase required for the conversion of demethylmenaquinol (DMKH2) to menaquinol (MKH2).
hepS protein networkhttps://string-db.org/network/866895.HBHAL_3284Heptaprenyl diphosphate synthase component I.
mtrB protein networkhttps://string-db.org/network/866895.HBHAL_3285Transcription attenuation protein MtrB; Required for transcription attenuation control in the Trp operon. This trans-acting factor seems to recognize a 10 bases nucleotide sequence in the Trp lea [...]
hupA protein networkhttps://string-db.org/network/866895.HBHAL_3286DNA-binding protein HU; Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions.
CCG45633.1 protein networkhttps://string-db.org/network/866895.HBHAL_3287Stage IV sporulation protein A; ATPase. Has a role at an early stage in the morphogenesis of the spore coat.
CCG45634.1 protein networkhttps://string-db.org/network/866895.HBHAL_3288Hypothetical protein.
CCG45635.1 protein networkhttps://string-db.org/network/866895.HBHAL_3289Hypothetical protein.
CCG45636.1 protein networkhttps://string-db.org/network/866895.HBHAL_3290Hypothetical protein.
yjcC2 protein networkhttps://string-db.org/network/866895.HBHAL_3291YjcC family transcription regulator.
gpsA protein networkhttps://string-db.org/network/866895.HBHAL_3292NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Belongs to the NAD-dependent glycerol-3-phosphate dehydrogenase family.
der protein networkhttps://string-db.org/network/866895.HBHAL_3293GTP-binding protein EngA; GTPase that plays an essential role in the late steps of ribosome biogenesis; Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. EngA (Der) G [...]
CCG45640.1 protein networkhttps://string-db.org/network/866895.HBHAL_3294Hypothetical protein.
CCG45641.1 protein networkhttps://string-db.org/network/866895.HBHAL_3295Conserved hypothetical protein.
CCG45642.1 protein networkhttps://string-db.org/network/866895.HBHAL_3296Hypothetical protein.
fni protein networkhttps://string-db.org/network/866895.HBHAL_3297Isopentenyl pyrophosphate isomerase; Involved in the biosynthesis of isoprenoids. Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its allylic isomer, dim [...]
rpsA protein networkhttps://string-db.org/network/866895.HBHAL_329830S ribosomal protein S1.
plsC protein networkhttps://string-db.org/network/866895.HBHAL_32991-acylglycerol-3-phosphate O-acyltransferase.
cmk protein networkhttps://string-db.org/network/866895.HBHAL_3300Cytidylate kinase.
ypfA protein networkhttps://string-db.org/network/866895.HBHAL_3301Hypothetical protein.
CCG45648.1 protein networkhttps://string-db.org/network/866895.HBHAL_3302Putative spore germination protein.
CCG45649.1 protein networkhttps://string-db.org/network/866895.HBHAL_3303Spore cortex-lytic enzyme prepeptide.
prsW protein networkhttps://string-db.org/network/866895.HBHAL_3304Protease PrsW; Involved in the degradation of specific anti-sigma factors. Belongs to the protease PrsW family.
CCG45651.1 protein networkhttps://string-db.org/network/866895.HBHAL_3305Hypothetical protein.
ansA protein networkhttps://string-db.org/network/866895.HBHAL_3306L-asparaginase.
CCG45653.1 protein networkhttps://string-db.org/network/866895.HBHAL_3307FAD-dependent oxidoreductase.
gdh1 protein networkhttps://string-db.org/network/866895.HBHAL_3308Glutamate dehydrogenase; Belongs to the Glu/Leu/Phe/Val dehydrogenases family.
ddlA protein networkhttps://string-db.org/network/866895.HBHAL_3309D-alanine--D-alanine ligase; Cell wall formation; Belongs to the D-alanine--D-alanine ligase family.
CCG45656.1 protein networkhttps://string-db.org/network/866895.HBHAL_3310Adaptor protein; Enables the recognition and targeting of unfolded and aggregated proteins to the ClpC protease or to other proteins involved in proteolysis; Belongs to the MecA family.
CCG45657.1 protein networkhttps://string-db.org/network/866895.HBHAL_3311MerR family transcription regulator.
ypbG protein networkhttps://string-db.org/network/866895.HBHAL_3312Phosphoesterase.
CCG45659.1 protein networkhttps://string-db.org/network/866895.HBHAL_3313CBS domain protein.
CCG45660.1 protein networkhttps://string-db.org/network/866895.HBHAL_3315Spore coat protein.
CCG45661.1 protein networkhttps://string-db.org/network/866895.HBHAL_3316Spore coat protein.
CCG45662.1 protein networkhttps://string-db.org/network/866895.HBHAL_3317Hypothetical protein.
ypbD protein networkhttps://string-db.org/network/866895.HBHAL_3318Conserved hypothetical protein.
recS protein networkhttps://string-db.org/network/866895.HBHAL_3319Probable ATP-dependent DNA helicase RecS.
ypbB protein networkhttps://string-db.org/network/866895.HBHAL_3320Conserved hypothetical protein.
fer protein networkhttps://string-db.org/network/866895.HBHAL_3321Ferredoxin.
CCG45667.1 protein networkhttps://string-db.org/network/866895.HBHAL_3322Hypothetical protein.
CCG45668.1 protein networkhttps://string-db.org/network/866895.HBHAL_3323RsiX type transcription regulator.
sigX protein networkhttps://string-db.org/network/866895.HBHAL_3324RNA polymerase sigma factor SigX; Belongs to the sigma-70 factor family. ECF subfamily.
CCG45671.1 protein networkhttps://string-db.org/network/866895.HBHAL_3326Hypothetical protein.
CCG45672.1 protein networkhttps://string-db.org/network/866895.HBHAL_3327Hypothetical protein.
CCG45673.1 protein networkhttps://string-db.org/network/866895.HBHAL_3328Two-component sensor histidine kinase.
CCG45674.1 protein networkhttps://string-db.org/network/866895.HBHAL_3329Two-component response regulator.
resC protein networkhttps://string-db.org/network/866895.HBHAL_3330Cytochrome c biogenesis protein ResC.
resB protein networkhttps://string-db.org/network/866895.HBHAL_3331Cytochrome c biogenesis protein ResB.
resA protein networkhttps://string-db.org/network/866895.HBHAL_3332Thiol-disulfide oxidoreductase ResA.
rluB protein networkhttps://string-db.org/network/866895.HBHAL_333323S rRNA pseudouridine synthase; Belongs to the pseudouridine synthase RsuA family.
CCG45679.1 protein networkhttps://string-db.org/network/866895.HBHAL_3334Spore maturation protein B.
CCG45680.1 protein networkhttps://string-db.org/network/866895.HBHAL_3335Spore maturation protein A.
dacB protein networkhttps://string-db.org/network/866895.HBHAL_3336D-alanyl-D-alanine carboxypeptidase; Belongs to the peptidase S11 family.
scpB protein networkhttps://string-db.org/network/866895.HBHAL_3337Segregation and condensation protein B; Participates in chromosomal partition during cell division. May act via the formation of a condensin-like complex containing Smc and ScpA that pull DNA awa [...]
scpA protein networkhttps://string-db.org/network/866895.HBHAL_3338Segregation and condensation protein A; Participates in chromosomal partition during cell division. May act via the formation of a condensin-like complex containing Smc and ScpB that pull DNA awa [...]
ypuF protein networkhttps://string-db.org/network/866895.HBHAL_3339Conserved hypothetical protein.
ribT protein networkhttps://string-db.org/network/866895.HBHAL_3340Riboflavin biosynthesis protein RibT.
CCG45686.1 protein networkhttps://string-db.org/network/866895.HBHAL_3341Hypothetical protein.
ppiB protein networkhttps://string-db.org/network/866895.HBHAL_3342Peptidylprolyl isomerase; PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides; Belongs to the cyclophilin-type PP [...]
lysA protein networkhttps://string-db.org/network/866895.HBHAL_3343Diaminopimelate decarboxylase; Specifically catalyzes the decarboxylation of meso- diaminopimelate (meso-DAP) to L-lysine.
CCG45689.1 protein networkhttps://string-db.org/network/866895.HBHAL_3344Stage V sporulation protein AF.
CCG45690.1 protein networkhttps://string-db.org/network/866895.HBHAL_3345Stage V sporulation protein AE.
CCG45691.1 protein networkhttps://string-db.org/network/866895.HBHAL_3346Stage V sporulation protein AD.
CCG45692.1 protein networkhttps://string-db.org/network/866895.HBHAL_3347Stage V sporulation protein AC.
CCG45693.1 protein networkhttps://string-db.org/network/866895.HBHAL_3348Stage V sporulation protein AB.
CCG45694.1 protein networkhttps://string-db.org/network/866895.HBHAL_3349Stage V sporulation protein AA.
sigF protein networkhttps://string-db.org/network/866895.HBHAL_3350RNA polymerase sigma factor SigF; Belongs to the sigma-70 factor family.
spoIIAB protein networkhttps://string-db.org/network/866895.HBHAL_3351Anti-sigma F factor; Binds to sigma F and blocks its ability to form an RNA polymerase holoenzyme (E-sigma F). Phosphorylates SpoIIAA on a serine residue. This phosphorylation may enable SpoIIAA [...]
CCG45697.1 protein networkhttps://string-db.org/network/866895.HBHAL_3352Anti-sigma F factor antagonist; Belongs to the anti-sigma-factor antagonist family.
dacF protein networkhttps://string-db.org/network/866895.HBHAL_3353Serine-type D-Ala-D-Ala carboxypeptidase; Belongs to the peptidase S11 family.
CCG45699.1 protein networkhttps://string-db.org/network/866895.HBHAL_3354Hypothetical protein.
pyn protein networkhttps://string-db.org/network/866895.HBHAL_3355Pyrimidine-nucleoside phosphorylase.
punA protein networkhttps://string-db.org/network/866895.HBHAL_3356Purine nucleoside phosphorylase; The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy)ribonucleoside molecules, with the formati [...]
deoB protein networkhttps://string-db.org/network/866895.HBHAL_3357Phosphopentomutase; Phosphotransfer between the C1 and C5 carbon atoms of pentose; Belongs to the phosphopentomutase family.
xerD protein networkhttps://string-db.org/network/866895.HBHAL_3358Site-specific tyrosine recombinase XerD; Site-specific tyrosine recombinase, which acts by catalyzing the cutting and rejoining of the recombining DNA molecules. The XerC- XerD complex is essenti [...]
CCG45704.1 protein networkhttps://string-db.org/network/866895.HBHAL_3359Fur family transcription regulator; Belongs to the Fur family.
CCG45705.1 protein networkhttps://string-db.org/network/866895.HBHAL_3360Stage II sporulation protein M; Required for complete septum migration and engulfment of the forespore compartment during sporulation. Required for stabilizing and recruiting of SpoIIP to the sep [...]
nudF protein networkhttps://string-db.org/network/866895.HBHAL_3361ADP-ribose pyrophosphatase.
CCG45707.1 protein networkhttps://string-db.org/network/866895.HBHAL_3362Aldo/keto reductase family protein.
CCG45708.1 protein networkhttps://string-db.org/network/866895.HBHAL_3363Membrane dipeptidase.
CCG45709.1 protein networkhttps://string-db.org/network/866895.HBHAL_3364Hypothetical protein.
CCG45710.1 protein networkhttps://string-db.org/network/866895.HBHAL_3365Group 1 glycosyltransferase.
CCG45711.1 protein networkhttps://string-db.org/network/866895.HBHAL_3366Putative MFS-type transporter; Belongs to the major facilitator superfamily.
CCG45712.1 protein networkhttps://string-db.org/network/866895.HBHAL_3367D-amino-acid dehydrogenase.
CCG45713.1 protein networkhttps://string-db.org/network/866895.HBHAL_3368ABC-type transport system extracellular binding protein (probable substrate peptide/nickel).
sppA protein networkhttps://string-db.org/network/866895.HBHAL_3369Probable signal peptide peptidase SppA.
yteJ protein networkhttps://string-db.org/network/866895.HBHAL_3370RDD domain protein.
cypA protein networkhttps://string-db.org/network/866895.HBHAL_3372Cytochrome P450.
CCG45717.1 protein networkhttps://string-db.org/network/866895.HBHAL_3373IS150-type transposase orfAB.
CCG45718.1 protein networkhttps://string-db.org/network/866895.HBHAL_3375Na+/H+ antiporter family protein.
CCG45719.1 protein networkhttps://string-db.org/network/866895.HBHAL_3376C60 family peptidase.
CCG45720.1 protein networkhttps://string-db.org/network/866895.HBHAL_3377Conserved hypothetical protein.
CCG45721.1 protein networkhttps://string-db.org/network/866895.HBHAL_3378Conserved hypothetical protein.
CCG45722.1 protein networkhttps://string-db.org/network/866895.HBHAL_3379Acetyltransferase, GNAT family.
CCG45723.1 protein networkhttps://string-db.org/network/866895.HBHAL_3380Hypothetical protein.
CCG45724.1 protein networkhttps://string-db.org/network/866895.HBHAL_3381GntR family transcription regulator.
CCG45725.1 protein networkhttps://string-db.org/network/866895.HBHAL_3382Hypothetical protein.
CCG45726.1 protein networkhttps://string-db.org/network/866895.HBHAL_3383Hypothetical protein.
CCG45728.1 protein networkhttps://string-db.org/network/866895.HBHAL_3385Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
metQ2 protein networkhttps://string-db.org/network/866895.HBHAL_3386ABC-type transport system extracellular binding protein (probable substrate methionine); Belongs to the nlpA lipoprotein family.
metP2 protein networkhttps://string-db.org/network/866895.HBHAL_3387ABC-type transport system permease protein (probable substrate methionine).
metN2 protein networkhttps://string-db.org/network/866895.HBHAL_3388ABC-type transport system ATP-binding protein (probable substrate methionine); Part of the ABC transporter complex MetNIQ involved in methionine import. Responsible for energy coupling to the tra [...]
CCG45732.1 protein networkhttps://string-db.org/network/866895.HBHAL_3389Alcohol dehydrogenase.
CCG45733.1 protein networkhttps://string-db.org/network/866895.HBHAL_3390Hypothetical protein.
CCG45734.1 protein networkhttps://string-db.org/network/866895.HBHAL_3391Hypothetical protein.
CCG45735.1 protein networkhttps://string-db.org/network/866895.HBHAL_3392Putative dioxygenase.
CCG45736.1 protein networkhttps://string-db.org/network/866895.HBHAL_3393Conserved hypothetical protein.
CCG45737.1 protein networkhttps://string-db.org/network/866895.HBHAL_3394Hypothetical protein.
CCG45738.1 protein networkhttps://string-db.org/network/866895.HBHAL_3395Hypothetical protein.
CCG45739.1 protein networkhttps://string-db.org/network/866895.HBHAL_3396Hypothetical protein.
CCG45740.1 protein networkhttps://string-db.org/network/866895.HBHAL_3397Hypothetical protein.
CCG45741.1 protein networkhttps://string-db.org/network/866895.HBHAL_3398Fibronectin-binding protein, putative.
CCG45742.1 protein networkhttps://string-db.org/network/866895.HBHAL_3399FAD-dependent pyridine nucleotide-disulphide oxidoreductase.
CCG45743.1 protein networkhttps://string-db.org/network/866895.HBHAL_3399_AConserved hypothetical protein.
CCG45744.1 protein networkhttps://string-db.org/network/866895.HBHAL_3400Hypothetical protein.
ykuD protein networkhttps://string-db.org/network/866895.HBHAL_3401Hypothetical protein.
CCG45746.1 protein networkhttps://string-db.org/network/866895.HBHAL_3402RNaseH domain protein.
CCG45747.1 protein networkhttps://string-db.org/network/866895.HBHAL_3403Hypothetical protein.
CCG45748.1 protein networkhttps://string-db.org/network/866895.HBHAL_3404Hypothetical protein.
yvbT protein networkhttps://string-db.org/network/866895.HBHAL_3405Luciferase family oxidoreductase.
ectD protein networkhttps://string-db.org/network/866895.HBHAL_3406Ectoine hydroxylase.
CCG45751.1 protein networkhttps://string-db.org/network/866895.HBHAL_3407Hypothetical protein.
CCG45752.1 protein networkhttps://string-db.org/network/866895.HBHAL_3408ABC-type transport system ATP-binding protein.
CCG45753.1 protein networkhttps://string-db.org/network/866895.HBHAL_3409Acetyltransferase, GNAT family.
CCG45754.1 protein networkhttps://string-db.org/network/866895.HBHAL_3410Hypothetical protein.
CCG45755.1 protein networkhttps://string-db.org/network/866895.HBHAL_3411Conserved hypothetical protein.
CCG45756.1 protein networkhttps://string-db.org/network/866895.HBHAL_3412Hypothetical protein.
CCG45757.1 protein networkhttps://string-db.org/network/866895.HBHAL_3413Hypothetical protein.
CCG45758.1 protein networkhttps://string-db.org/network/866895.HBHAL_3414Hypothetical protein.
CCG45759.1 protein networkhttps://string-db.org/network/866895.HBHAL_3415Hypothetical protein.
CCG45760.1 protein networkhttps://string-db.org/network/866895.HBHAL_3416Hypothetical protein.
CCG45761.1 protein networkhttps://string-db.org/network/866895.HBHAL_3417Hypothetical protein.
thiF protein networkhttps://string-db.org/network/866895.HBHAL_3418Thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein.
thiG protein networkhttps://string-db.org/network/866895.HBHAL_3419Thiazole synthase; Catalyzes the rearrangement of 1-deoxy-D-xylulose 5-phosphate (DXP) to produce the thiazole phosphate moiety of thiamine. Sulfur is provided by the thiocarboxylate moiety of th [...]
thiS protein networkhttps://string-db.org/network/866895.HBHAL_3420ThiS protein.
CCG45765.1 protein networkhttps://string-db.org/network/866895.HBHAL_3421Glycine oxidase.
CCG45766.1 protein networkhttps://string-db.org/network/866895.HBHAL_3422tenI family protein.
CCG45767.1 protein networkhttps://string-db.org/network/866895.HBHAL_3423Na+/Ca2+ antiporter family protein.
CCG45768.1 protein networkhttps://string-db.org/network/866895.HBHAL_3424Hypothetical protein.
CCG45769.1 protein networkhttps://string-db.org/network/866895.HBHAL_3425Hypothetical protein; Belongs to the HesB/IscA family.
CCG45770.1 protein networkhttps://string-db.org/network/866895.HBHAL_3426Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG45771.1 protein networkhttps://string-db.org/network/866895.HBHAL_3427Zn-dependent hydrolase.
CCG45772.1 protein networkhttps://string-db.org/network/866895.HBHAL_3428Putative AbgT transporter family protein.
CCG45773.1 protein networkhttps://string-db.org/network/866895.HBHAL_3429M20 family peptidase.
glpQ protein networkhttps://string-db.org/network/866895.HBHAL_3430Glycerophosphoryl diester phosphodiesterase.
CCG45775.1 protein networkhttps://string-db.org/network/866895.HBHAL_3431Group 2 glycosyltransferase.
namA protein networkhttps://string-db.org/network/866895.HBHAL_3432NAD(P)H dehydrogenase; Catalyzes the reduction of the double bond of an array of alpha,beta-unsaturated aldehydes and ketones. It also reduces the nitro group of nitroester and nitroaromatic comp [...]
CCG45777.1 protein networkhttps://string-db.org/network/866895.HBHAL_3433Hypothetical protein.
rnz protein networkhttps://string-db.org/network/866895.HBHAL_3434Ribonuclease Z; Zinc phosphodiesterase, which displays some tRNA 3'- processing endonuclease activity. Probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA; Belongs [...]
CCG45779.1 protein networkhttps://string-db.org/network/866895.HBHAL_3435Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
CCG45780.1 protein networkhttps://string-db.org/network/866895.HBHAL_3436IS1341-type transposase.
CCG45781.1 protein networkhttps://string-db.org/network/866895.HBHAL_3437Hypothetical protein.
CCG45782.1 protein networkhttps://string-db.org/network/866895.HBHAL_3438Hypothetical protein.
ycgF protein networkhttps://string-db.org/network/866895.HBHAL_3439Hypothetical protein.
ycgH protein networkhttps://string-db.org/network/866895.HBHAL_3440Transport protein.
CCG45785.1 protein networkhttps://string-db.org/network/866895.HBHAL_3441Hypothetical protein.
CCG45786.1 protein networkhttps://string-db.org/network/866895.HBHAL_3442Hypothetical protein.
yqjH protein networkhttps://string-db.org/network/866895.HBHAL_3443DNA polymerase IV; Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misa [...]
CCG45788.1 protein networkhttps://string-db.org/network/866895.HBHAL_3444Peptidase.
CCG45789.1 protein networkhttps://string-db.org/network/866895.HBHAL_3445Carboxyl transferase.
CCG45790.1 protein networkhttps://string-db.org/network/866895.HBHAL_3446methylmalonyl-CoA mutase small subunit.
CCG45791.1 protein networkhttps://string-db.org/network/866895.HBHAL_3447methylmalonyl-CoA mutase large subunit.
CCG45792.1 protein networkhttps://string-db.org/network/866895.HBHAL_3448Hypothetical protein.
CCG45793.1 protein networkhttps://string-db.org/network/866895.HBHAL_3449Conserved hypothetical protein.
CCG45794.1 protein networkhttps://string-db.org/network/866895.HBHAL_3450IS1341-type transposase.
yqjA protein networkhttps://string-db.org/network/866895.HBHAL_3451Hypothetical protein.
yqiW protein networkhttps://string-db.org/network/866895.HBHAL_3452Hypothetical protein; Belongs to the UPF0403 family.
CCG45798.1 protein networkhttps://string-db.org/network/866895.HBHAL_3454Dihydrolipoamide acetyltransferase.
CCG45799.1 protein networkhttps://string-db.org/network/866895.HBHAL_34553-methyl-2-oxobutanoate dehydrogenase beta subunit.
CCG45800.1 protein networkhttps://string-db.org/network/866895.HBHAL_34563-methyl-2-oxobutanoate dehydrogenase alpha subunit.
lpdV protein networkhttps://string-db.org/network/866895.HBHAL_3457Dihydrolipoamide dehydrogenase.
buk protein networkhttps://string-db.org/network/866895.HBHAL_3458Butyrate kinase; Belongs to the acetokinase family.
ldh protein networkhttps://string-db.org/network/866895.HBHAL_3459Leucine dehydrogenase; Belongs to the Glu/Leu/Phe/Val dehydrogenases family.
yqiS protein networkhttps://string-db.org/network/866895.HBHAL_3460Phosphate butyryltransferase.
yqiR protein networkhttps://string-db.org/network/866895.HBHAL_3461YqiR family transcription regulator.
CCG45806.1 protein networkhttps://string-db.org/network/866895.HBHAL_3462Hypothetical protein.
CCG45807.1 protein networkhttps://string-db.org/network/866895.HBHAL_3463Conserved hypothetical protein.
CCG45808.1 protein networkhttps://string-db.org/network/866895.HBHAL_3464DNA polymerase III epsilon subunit.
dapG2 protein networkhttps://string-db.org/network/866895.HBHAL_3465Aspartate kinase; Belongs to the aspartokinase family.
CCG45810.1 protein networkhttps://string-db.org/network/866895.HBHAL_3466Two-component response regulator; May play the central regulatory role in sporulation. It may be an element of the effector pathway responsible for the activation of sporulation genes in response [...]
CCG45811.1 protein networkhttps://string-db.org/network/866895.HBHAL_3467Stage IV sporulation protein B.
recN protein networkhttps://string-db.org/network/866895.HBHAL_3468DNA repair protein RecN; May be involved in recombinational repair of damaged DNA.
argR protein networkhttps://string-db.org/network/866895.HBHAL_3469Arginine repressor; Regulates arginine biosynthesis genes.
yqxC protein networkhttps://string-db.org/network/866895.HBHAL_3470Conserved hypothetical protein.
dxs protein networkhttps://string-db.org/network/866895.HBHAL_34711-deoxy-D-xylulose-5-phosphate synthase; Catalyzes the acyloin condensation reaction between C atoms 2 and 3 of pyruvate and glyceraldehyde 3-phosphate to yield 1-deoxy-D- xylulose-5-phosphate (D [...]
CCG45816.1 protein networkhttps://string-db.org/network/866895.HBHAL_3472Conserved hypothetical protein.
CCG45817.1 protein networkhttps://string-db.org/network/866895.HBHAL_3473Hypothetical protein.
yqiD protein networkhttps://string-db.org/network/866895.HBHAL_3474Geranyltranstransferase; Belongs to the FPP/GGPP synthase family.
xseB protein networkhttps://string-db.org/network/866895.HBHAL_3475Exodeoxyribonuclease VII small subunit; Bidirectionally degrades single-stranded DNA into large acid- insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucl [...]
xseA protein networkhttps://string-db.org/network/866895.HBHAL_3476Exodeoxyribonuclease VII large subunit; Bidirectionally degrades single-stranded DNA into large acid- insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucl [...]
folD protein networkhttps://string-db.org/network/866895.HBHAL_3477Methenyltetrahydrofolate cyclohydrolase; Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10- methenyltetrahydrofolate to 10 [...]
nusB protein networkhttps://string-db.org/network/866895.HBHAL_3478Transcription antitermination protein NusB; Involved in transcription antitermination. Required for transcription of ribosomal RNA (rRNA) genes. Binds specifically to the boxA antiterminator sequ [...]
yqhY protein networkhttps://string-db.org/network/866895.HBHAL_3479Hypothetical protein.
accC protein networkhttps://string-db.org/network/866895.HBHAL_3480acetyl-CoA carboxylase biotin carboxylase subunit; This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of the carrier p [...]
accB protein networkhttps://string-db.org/network/866895.HBHAL_3481acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; This protein is a component of the acetyl coenzyme A carboxylase complex; first, biotin carboxylase catalyzes the carboxylation of [...]
CCG45826.1 protein networkhttps://string-db.org/network/866895.HBHAL_3482Stage III sporulation protein AH.
CCG45827.1 protein networkhttps://string-db.org/network/866895.HBHAL_3483Stage III sporulation protein AG.
CCG45828.1 protein networkhttps://string-db.org/network/866895.HBHAL_3484Stage III sporulation protein AF.
CCG45829.1 protein networkhttps://string-db.org/network/866895.HBHAL_3485Stage III sporulation protein AE.
CCG45830.1 protein networkhttps://string-db.org/network/866895.HBHAL_3486Stage III sporulation protein AD.
CCG45831.1 protein networkhttps://string-db.org/network/866895.HBHAL_3487Stage III sporulation protein AC.
CCG45832.1 protein networkhttps://string-db.org/network/866895.HBHAL_3488Stage III sporulation protein SpoAB.
CCG45833.1 protein networkhttps://string-db.org/network/866895.HBHAL_3489Stage III sporulation protein AA.
efp protein networkhttps://string-db.org/network/866895.HBHAL_3490Elongation factor P; Involved in peptide bond synthesis. Stimulates efficient translation and peptide-bond synthesis on native or reconstituted 70S ribosomes in vitro. Probably functions indirect [...]
CCG45835.1 protein networkhttps://string-db.org/network/866895.HBHAL_3491M24 family peptidase C-term region.
CCG45836.1 protein networkhttps://string-db.org/network/866895.HBHAL_3492M24 family peptidase N-term region.
aroQ protein networkhttps://string-db.org/network/866895.HBHAL_34933-dehydroquinate dehydratase; Catalyzes a trans-dehydration via an enolate intermediate. Belongs to the type-II 3-dehydroquinase family.
yqhR protein networkhttps://string-db.org/network/866895.HBHAL_3494Hypothetical protein.
CCG45839.1 protein networkhttps://string-db.org/network/866895.HBHAL_3495Hypothetical protein.
yqhO protein networkhttps://string-db.org/network/866895.HBHAL_3496NTE family protein.
mntR protein networkhttps://string-db.org/network/866895.HBHAL_3497Iron-dependent repressor family protein; Central regulator of manganese homeostasis. Belongs to the DtxR/MntR family.
CCG45842.1 protein networkhttps://string-db.org/network/866895.HBHAL_3498Ribonucleotide-diphosphate reductase alpha subunit C-terminal domain.
CCG45843.1 protein networkhttps://string-db.org/network/866895.HBHAL_3499Ribonucleotide-diphosphate reductase alpha subunit N-terminal domain.
yqhL protein networkhttps://string-db.org/network/866895.HBHAL_3500Rhodanese domain protein.
gcvPB protein networkhttps://string-db.org/network/866895.HBHAL_3501Glycine dehydrogenase subunit 2; The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; C [...]
gcvPA protein networkhttps://string-db.org/network/866895.HBHAL_3502Glycine dehydrogenase subunit 1; The glycine cleavage system catalyzes the degradation of glycine. The P protein binds the alpha-amino group of glycine through its pyridoxal phosphate cofactor; C [...]
gcvT protein networkhttps://string-db.org/network/866895.HBHAL_3503Aminomethyltransferase; The glycine cleavage system catalyzes the degradation of glycine.
CCG45848.1 protein networkhttps://string-db.org/network/866895.HBHAL_3504Homolog to ATP-dependent RNA helicase.
yqhG protein networkhttps://string-db.org/network/866895.HBHAL_3505Hypothetical protein.
CCG45850.1 protein networkhttps://string-db.org/network/866895.HBHAL_3506Hypothetical protein.
aroK protein networkhttps://string-db.org/network/866895.HBHAL_3507Shikimate kinase; Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate; Belongs to the shikimate kinase family.
comGA protein networkhttps://string-db.org/network/866895.HBHAL_3508ComG operon protein 1.
CCG45853.1 protein networkhttps://string-db.org/network/866895.HBHAL_3509Conserved hypothetical protein.
comGC protein networkhttps://string-db.org/network/866895.HBHAL_3510ComG operon protein 3; Required for transformation and DNA binding.
comGD protein networkhttps://string-db.org/network/866895.HBHAL_3510_AComG operon protein 4.
CCG45856.1 protein networkhttps://string-db.org/network/866895.HBHAL_3511Hypothetical protein.
CCG45857.1 protein networkhttps://string-db.org/network/866895.HBHAL_3512Hypothetical protein.
mgsR protein networkhttps://string-db.org/network/866895.HBHAL_3513Stress response modulator MgsR; Belongs to the ArsC family.
yqgY protein networkhttps://string-db.org/network/866895.HBHAL_3514Conserved hypothetical protein.
yqgX protein networkhttps://string-db.org/network/866895.HBHAL_3515Metallo-beta-lactamase family protein.
CCG45861.1 protein networkhttps://string-db.org/network/866895.HBHAL_3516Probable ABC-type transport system permease protein.
CCG45862.1 protein networkhttps://string-db.org/network/866895.HBHAL_3517ABC-type transport system ATP-binding protein; Belongs to the ABC transporter superfamily.
yqgS3 protein networkhttps://string-db.org/network/866895.HBHAL_3518YqgS family protein; Belongs to the LTA synthase family.
CCG45864.1 protein networkhttps://string-db.org/network/866895.HBHAL_3519ROK family protein.
CCG45865.1 protein networkhttps://string-db.org/network/866895.HBHAL_3520Hypothetical protein.
CCG45866.1 protein networkhttps://string-db.org/network/866895.HBHAL_3521Stage V sporulation protein AF.
CCG45867.1 protein networkhttps://string-db.org/network/866895.HBHAL_3522Hypothetical protein.
yqgP protein networkhttps://string-db.org/network/866895.HBHAL_3523S54 family peptidase.
ldh1 protein networkhttps://string-db.org/network/866895.HBHAL_3524L-lactate dehydrogenase; Catalyzes the conversion of lactate to pyruvate. Belongs to the LDH/MDH superfamily. LDH family.
CCG45870.1 protein networkhttps://string-db.org/network/866895.HBHAL_35255-formyltetrahydrofolate cyclo-ligase family protein; Belongs to the 5-formyltetrahydrofolate cyclo-ligase family.
CCG45871.1 protein networkhttps://string-db.org/network/866895.HBHAL_3526Hypothetical protein.
rpmG2 protein networkhttps://string-db.org/network/866895.HBHAL_3526_A50S ribosomal protein L33; Belongs to the bacterial ribosomal protein bL33 family.
CCG45873.1 protein networkhttps://string-db.org/network/866895.HBHAL_3527Hypothetical protein.
CCG45874.1 protein networkhttps://string-db.org/network/866895.HBHAL_3528Phosphate transport system regulatory protein; Plays a role in the regulation of phosphate uptake.
pstB protein networkhttps://string-db.org/network/866895.HBHAL_3529ABC-type transport system ATP-binding protein (probable substrate phosphate); Part of the ABC transporter complex PstSACB involved in phosphate import. Responsible for energy coupling to the tran [...]
CCG45876.1 protein networkhttps://string-db.org/network/866895.HBHAL_3530ABC-type transport system permease protein (probable substrate phosphate).
CCG45877.1 protein networkhttps://string-db.org/network/866895.HBHAL_3531ABC-type transport system permease protein (probables substrate phosphate); Part of the binding-protein-dependent transport system for phosphate; probably responsible for the translocation of the [...]
CCG45878.1 protein networkhttps://string-db.org/network/866895.HBHAL_3532ABC-type transport system extracellular binding protein (probable substrate phosphate).
pbpA protein networkhttps://string-db.org/network/866895.HBHAL_3533Penicillin-binding protein.
CCG45880.1 protein networkhttps://string-db.org/network/866895.HBHAL_3534Putative MFS-type transporter.
sodA protein networkhttps://string-db.org/network/866895.HBHAL_3535Superoxide dismutase (Mn); Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Belongs to the iron/manganese superoxide dismutase family.
CCG45883.1 protein networkhttps://string-db.org/network/866895.HBHAL_3537Hypothetical protein.
ispG protein networkhttps://string-db.org/network/866895.HBHAL_35384-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Converts 2C-methyl-D-erythritol 2,4-cyclodiphosphate (ME- 2,4cPP) into 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate. Belongs to the IspG fa [...]
CCG45885.1 protein networkhttps://string-db.org/network/866895.HBHAL_3539Hypothetical protein.
CCG45886.1 protein networkhttps://string-db.org/network/866895.HBHAL_3540Hypothetical protein.
nfo protein networkhttps://string-db.org/network/866895.HBHAL_3541Endonuclease IV; Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-p [...]
cshB protein networkhttps://string-db.org/network/866895.HBHAL_3542DEAD-box ATP-dependent RNA helicase CshB.
ispH protein networkhttps://string-db.org/network/866895.HBHAL_35434-hydroxy-3-methylbut-2-enyl diphosphate reductase; Catalyzes the conversion of 1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate (HMBPP) into a mixture of isopentenyl diphosphate (IPP) and dimethyl [...]
yqfO protein networkhttps://string-db.org/network/866895.HBHAL_3544Conserved hypothetical protein; Belongs to the GTP cyclohydrolase I type 2/NIF3 family.
yqfN protein networkhttps://string-db.org/network/866895.HBHAL_3545Conserved hypothetical protein.
cccA protein networkhttps://string-db.org/network/866895.HBHAL_3546Cytochrome c-550.
sigA protein networkhttps://string-db.org/network/866895.HBHAL_3547RNA polymerase sigma factor SigA; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released. This sigma factor is the p [...]
dnaG protein networkhttps://string-db.org/network/866895.HBHAL_3548DNA primase; RNA polymerase that catalyzes the synthesis of short RNA molecules used as primers for DNA polymerase during DNA replication.
yqxD protein networkhttps://string-db.org/network/866895.HBHAL_3549Conserved hypothetical protein; Belongs to the UPF0178 family.
yqfL1 protein networkhttps://string-db.org/network/866895.HBHAL_3550Probable phosphotransferase YqfL; Bifunctional serine/threonine kinase and phosphorylase involved in the regulation of the pyruvate, phosphate dikinase (PPDK) by catalyzing its phosphorylation/de [...]
yqzB protein networkhttps://string-db.org/network/866895.HBHAL_3551Hypothetical protein.
glyS protein networkhttps://string-db.org/network/866895.HBHAL_3552glycyl-tRNA synthetase beta subunit.
glyQ protein networkhttps://string-db.org/network/866895.HBHAL_3553glycyl-tRNA synthetase alpha subunit.
CCG45900.1 protein networkhttps://string-db.org/network/866895.HBHAL_3554Hypothetical protein.
recO protein networkhttps://string-db.org/network/866895.HBHAL_3555DNA repair protein RecO; Involved in DNA repair and RecF pathway recombination.
CCG45902.1 protein networkhttps://string-db.org/network/866895.HBHAL_3556Hypothetical protein.
CCG45903.1 protein networkhttps://string-db.org/network/866895.HBHAL_3557Hypothetical protein.
era protein networkhttps://string-db.org/network/866895.HBHAL_3558GTP-binding protein Era; An essential GTPase that binds both GDP and GTP, with rapid nucleotide exchange. Plays a role in 16S rRNA processing and 30S ribosomal subunit biogenesis and possibly als [...]
dgkA protein networkhttps://string-db.org/network/866895.HBHAL_3559Diacylglycerol kinase.
ybeY protein networkhttps://string-db.org/network/866895.HBHAL_3560Probable rRNA maturation factor; Single strand-specific metallo-endoribonuclease involved in late-stage 70S ribosome quality control and in maturation of the 3' terminus of the 16S rRNA.
phoH protein networkhttps://string-db.org/network/866895.HBHAL_3561PhoH protein.
CCG45908.1 protein networkhttps://string-db.org/network/866895.HBHAL_3562Similar to stage IV sporulation protein.
CCG45909.1 protein networkhttps://string-db.org/network/866895.HBHAL_3563Conserved hypothetical protein.
CCG45910.1 protein networkhttps://string-db.org/network/866895.HBHAL_3564Hypothetical protein.
yqfA protein networkhttps://string-db.org/network/866895.HBHAL_3565UPF0365 family protein.
CCG45912.1 protein networkhttps://string-db.org/network/866895.HBHAL_3566Conserved hypothetical protein.
yqeY protein networkhttps://string-db.org/network/866895.HBHAL_3567Conserved hypothetical protein.
rpsU protein networkhttps://string-db.org/network/866895.HBHAL_356830S ribosomal protein S21; Belongs to the bacterial ribosomal protein bS21 family.
deoC protein networkhttps://string-db.org/network/866895.HBHAL_3569Deoxyribose-phosphate aldolase; Catalyzes a reversible aldol reaction between acetaldehyde and D-glyceraldehyde 3-phosphate to generate 2-deoxy-D-ribose 5- phosphate; Belongs to the DeoC/FbaB ald [...]
CCG45916.1 protein networkhttps://string-db.org/network/866895.HBHAL_3570Conserved hypothetical protein; Specifically methylates the N3 position of the uracil ring of uridine 1498 (m3U1498) in 16S rRNA. Acts on the fully assembled 30S ribosomal subunit.
prmA protein networkhttps://string-db.org/network/866895.HBHAL_3571Ribosomal protein L11 methyltransferase; Methylates ribosomal protein L11; Belongs to the methyltransferase superfamily. PrmA family.
dnaJ protein networkhttps://string-db.org/network/866895.HBHAL_3572Chaperone protein DnaJ; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an [...]
dnaK protein networkhttps://string-db.org/network/866895.HBHAL_3573Molecular chaperone DnaK; Acts as a chaperone; Belongs to the heat shock protein 70 family.
grpE protein networkhttps://string-db.org/network/866895.HBHAL_3574GrpE protein; Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins, in association with DnaK and GrpE. It is the nucleot [...]
hrcA protein networkhttps://string-db.org/network/866895.HBHAL_3575Heat-inducible transcription repressor HrcA; Negative regulator of class I heat shock genes (grpE-dnaK- dnaJ and groELS operons). Prevents heat-shock induction of these operons.
hemN protein networkhttps://string-db.org/network/866895.HBHAL_3576Coproporphyrinogen III oxidase; Probably acts as a heme chaperone, transferring heme to an unknown acceptor. Binds one molecule of heme per monomer, possibly covalently. Binds 1 [4Fe-4S] cluster. [...]
lepA protein networkhttps://string-db.org/network/866895.HBHAL_3577GTP-binding protein; Required for accurate and efficient protein synthesis under certain stress conditions. May act as a fidelity factor of the translation reaction, by catalyzing a one-codon bac [...]
CCG45924.1 protein networkhttps://string-db.org/network/866895.HBHAL_3578Hypothetical protein.
CCG45925.1 protein networkhttps://string-db.org/network/866895.HBHAL_3579Stage II sporulation protein P.
gpr protein networkhttps://string-db.org/network/866895.HBHAL_3580Germination proteinase; Initiates the rapid degradation of small, acid-soluble proteins during spore germination; Belongs to the peptidase A25 family.
rpsT protein networkhttps://string-db.org/network/866895.HBHAL_358130S ribosomal protein S20; Binds directly to 16S ribosomal RNA.
holA protein networkhttps://string-db.org/network/866895.HBHAL_3582DNA polymerase III delta subunit.
CCG45929.1 protein networkhttps://string-db.org/network/866895.HBHAL_3583Hypothetical protein.
comEC protein networkhttps://string-db.org/network/866895.HBHAL_3584Competence protein ComEC.
comEB protein networkhttps://string-db.org/network/866895.HBHAL_3585ComE operon protein 2.
comEA protein networkhttps://string-db.org/network/866895.HBHAL_3586Competence protein ComEA.
comER protein networkhttps://string-db.org/network/866895.HBHAL_3587ComE operon protein 4; Catalyzes the reduction of 1-pyrroline-5-carboxylate (PCA) to L-proline.
CCG45934.1 protein networkhttps://string-db.org/network/866895.HBHAL_3588Conserved hypothetical protein.
rsfS protein networkhttps://string-db.org/network/866895.HBHAL_3589Conserved hypothetical protein; Functions as a ribosomal silencing factor. Interacts with ribosomal protein L14 (rplN), blocking formation of intersubunit bridge B8. Prevents association of the 3 [...]
yqeK protein networkhttps://string-db.org/network/866895.HBHAL_3590Hypothetical protein.
nadD protein networkhttps://string-db.org/network/866895.HBHAL_3591Nicotinic acid mononucleotide adenyltransferase; Catalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD).
yqeI protein networkhttps://string-db.org/network/866895.HBHAL_3592Probable RNA-binding protein YqeI.
aroE protein networkhttps://string-db.org/network/866895.HBHAL_3593Shikimate 5-dehydrogenase; Involved in the biosynthesis of the chorismate, which leads to the biosynthesis of aromatic amino acids. Catalyzes the reversible NADPH linked reduction of 3-dehydroshi [...]
CCG45940.1 protein networkhttps://string-db.org/network/866895.HBHAL_3594GTPase familiy protein.
yqeG protein networkhttps://string-db.org/network/866895.HBHAL_3595HAD superfamily hydrolase.
CCG45942.1 protein networkhttps://string-db.org/network/866895.HBHAL_3596Hypothetical protein.
CCG45943.1 protein networkhttps://string-db.org/network/866895.HBHAL_3597Monovalent cation/H+ antiporter subunit A.
CCG45944.1 protein networkhttps://string-db.org/network/866895.HBHAL_3598Monovalent cation/H+ antiporter subunit C.
CCG45945.1 protein networkhttps://string-db.org/network/866895.HBHAL_3599Monovalent cation/H+ antiporter subunit D.
CCG45946.1 protein networkhttps://string-db.org/network/866895.HBHAL_3600Monovalent cation/H+ antiporter subunit E.
CCG45947.1 protein networkhttps://string-db.org/network/866895.HBHAL_3601Monovalent cation/H+ antiporter subunit F.
CCG45948.1 protein networkhttps://string-db.org/network/866895.HBHAL_3602Monovalent cation/H+ antiporter subunit G.
sigK protein networkhttps://string-db.org/network/866895.HBHAL_3603RNA polymerase sigma factor SigK; Sigma factors are initiation factors that promote the attachment of RNA polymerase to specific initiation sites and are then released.
CCG45950.1 protein networkhttps://string-db.org/network/866895.HBHAL_3604Hypothetical protein.
mtnN1 protein networkhttps://string-db.org/network/866895.HBHAL_36055'-methylthioadenosine/ S-adenosylhomocysteinenucleosidase; Catalyzes the irreversible cleavage of the glycosidic bond in both 5'-methylthioadenosine (MTA) and S-adenosylhomocysteine (SAH/AdoHcy) [...]
CCG45952.1 protein networkhttps://string-db.org/network/866895.HBHAL_3606Conserved hypothetical protein.
greA protein networkhttps://string-db.org/network/866895.HBHAL_3607Transcription elongation factor GreA; Necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trappi [...]
udk protein networkhttps://string-db.org/network/866895.HBHAL_3608Uridine kinase.
yrrM protein networkhttps://string-db.org/network/866895.HBHAL_3609Probable O-methyltransferase YrrM.
mltG protein networkhttps://string-db.org/network/866895.HBHAL_3610UPF0755 family protein; Functions as a peptidoglycan terminase that cleaves nascent peptidoglycan strands endolytically to terminate their elongation. Belongs to the transglycosylase MltG family.
CCG45957.1 protein networkhttps://string-db.org/network/866895.HBHAL_3611UPF0473 family protein; Belongs to the UPF0473 family.
yrrK protein networkhttps://string-db.org/network/866895.HBHAL_3612Probable Holliday junction resolvase; Could be a nuclease involved in processing of the 5'-end of pre-16S rRNA; Belongs to the YqgF HJR family.
yrzL protein networkhttps://string-db.org/network/866895.HBHAL_3613Hypothetical protein; Belongs to the UPF0297 family.
alaS protein networkhttps://string-db.org/network/866895.HBHAL_3614alanyl-tRNA synthetase; Catalyzes the attachment of alanine to tRNA(Ala) in a two- step reaction: alanine is first activated by ATP to form Ala-AMP and then transferred to the acceptor end of tRN [...]
CCG45961.1 protein networkhttps://string-db.org/network/866895.HBHAL_3615UPF0118 family protein.
CCG45962.1 protein networkhttps://string-db.org/network/866895.HBHAL_3616Hypothetical protein.
recD protein networkhttps://string-db.org/network/866895.HBHAL_3617Exodeoxyribonuclease V alpha subunit; DNA-dependent ATPase and ATP-dependent 5'-3' DNA helicase. Has no activity on blunt DNA or DNA with 3'-overhangs, requires at least 10 bases of 5'-ssDNA for [...]
CCG45964.1 protein networkhttps://string-db.org/network/866895.HBHAL_3618TPR domain protein.
mnmA protein networkhttps://string-db.org/network/866895.HBHAL_3620tRNA(5-methylaminomethyl-2-thiouridylate)- methyltransferase; Catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34.
CCG45966.1 protein networkhttps://string-db.org/network/866895.HBHAL_3621Aminotransferase.
cymR protein networkhttps://string-db.org/network/866895.HBHAL_3622Transcription regulator CymR.
yyaS6 protein networkhttps://string-db.org/network/866895.HBHAL_3623Conserved hypothetical protein.
CCG45969.1 protein networkhttps://string-db.org/network/866895.HBHAL_3624ATPase, AAA family.
rsfA protein networkhttps://string-db.org/network/866895.HBHAL_3625Prespore-specific transcription regulator RsfA.
aspS protein networkhttps://string-db.org/network/866895.HBHAL_3626aspartyl-tRNA synthetase; Catalyzes the attachment of L-aspartate to tRNA(Asp) in a two-step reaction: L-aspartate is first activated by ATP to form Asp- AMP and then transferred to the acceptor [...]
hisS protein networkhttps://string-db.org/network/866895.HBHAL_3627histidyl-tRNA synthetase.
CCG45973.1 protein networkhttps://string-db.org/network/866895.HBHAL_3628Hypothetical protein.
CCG45974.1 protein networkhttps://string-db.org/network/866895.HBHAL_3629Putative N-acetylmuramoyl-L-alanine amidase.
yrvI protein networkhttps://string-db.org/network/866895.HBHAL_3630D-tyrosyl-tRNA deacylase; An aminoacyl-tRNA editing enzyme that deacylates mischarged D-aminoacyl-tRNAs. Also deacylates mischarged glycyl-tRNA(Ala), protecting cells against glycine mischarging [...]
relA protein networkhttps://string-db.org/network/866895.HBHAL_3631GTP pyrophosphokinase; In eubacteria ppGpp (guanosine 3'-diphosphate 5-' diphosphate) is a mediator of the stringent response that coordinates a variety of cellular activities in response to chan [...]
apt protein networkhttps://string-db.org/network/866895.HBHAL_3632Adenine phosphoribosyltransferase; Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
recJ protein networkhttps://string-db.org/network/866895.HBHAL_3633single-stranded-DNA-specific exonuclease RecJ.
CCG45979.1 protein networkhttps://string-db.org/network/866895.HBHAL_3634Hypothetical protein.
secF protein networkhttps://string-db.org/network/866895.HBHAL_3635Protein-export membrane protein SecDF; Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. SecDF uses the proton motive force (PMF) to complete p [...]
CCG45981.1 protein networkhttps://string-db.org/network/866895.HBHAL_3636Stage V sporulation protein B.
yrbG protein networkhttps://string-db.org/network/866895.HBHAL_3637Hypothetical protein.
CCG45983.1 protein networkhttps://string-db.org/network/866895.HBHAL_3638Putative arsenical pump membrane protein.
CCG45984.1 protein networkhttps://string-db.org/network/866895.HBHAL_3639Hypothetical protein.
yajC protein networkhttps://string-db.org/network/866895.HBHAL_3640Preprotein translocase subunit YajC.
tgt protein networkhttps://string-db.org/network/866895.HBHAL_3641Queuine tRNA-ribosyltransferase; Catalyzes the base-exchange of a guanine (G) residue with the queuine precursor 7-aminomethyl-7-deazaguanine (PreQ1) at position 34 (anticodon wobble position) in [...]
queA protein networkhttps://string-db.org/network/866895.HBHAL_3642S-adenosylmethionine:tRNAribosyltransferase- isomerase; Transfers and isomerizes the ribose moiety from AdoMet to the 7-aminomethyl group of 7-deazaguanine (preQ1-tRNA) to give epoxyqueuosine (oQ [...]
CCG45988.1 protein networkhttps://string-db.org/network/866895.HBHAL_3643Hypothetical protein.
ruvB protein networkhttps://string-db.org/network/866895.HBHAL_3644Holliday junction ATP-dependent DNA helicase RuvB; The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may [...]
ruvA protein networkhttps://string-db.org/network/866895.HBHAL_3645Holliday junction ATP-dependent DNA helicase RuvA; The RuvA-RuvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may [...]
CCG45991.1 protein networkhttps://string-db.org/network/866895.HBHAL_3646Bypass-of-forespore protein C, putative.
CCG45992.1 protein networkhttps://string-db.org/network/866895.HBHAL_3647UPF0082 family protein.
CCG45993.1 protein networkhttps://string-db.org/network/866895.HBHAL_3648Hypothetical protein.
nadE2 protein networkhttps://string-db.org/network/866895.HBHAL_3649NH3-dependent NAD+ synthetase; Catalyzes the ATP-dependent amidation of deamido-NAD to form NAD. Uses ammonia as a nitrogen source; Belongs to the NAD synthetase family.
CCG45995.1 protein networkhttps://string-db.org/network/866895.HBHAL_3650Hypothetical protein.
CCG45996.1 protein networkhttps://string-db.org/network/866895.HBHAL_3651Conserved hypothetical protein.
pheA protein networkhttps://string-db.org/network/866895.HBHAL_3652Prephenate dehydratase.
yszB protein networkhttps://string-db.org/network/866895.HBHAL_3653UPF0735 family protein; Belongs to the UPF0735 family.
obg protein networkhttps://string-db.org/network/866895.HBHAL_3654GTPase Obg; An essential GTPase which binds GTP, GDP and possibly (p)ppGpp with moderate affinity, with high nucleotide exchange rates and a fairly low GTP hydrolysis rate. Plays a role in contro [...]
CCG46000.1 protein networkhttps://string-db.org/network/866895.HBHAL_3655Putative sporulation initiation phosphotransferase.
rpmA protein networkhttps://string-db.org/network/866895.HBHAL_365650S ribosomal protein L27; Belongs to the bacterial ribosomal protein bL27 family.
CCG46002.1 protein networkhttps://string-db.org/network/866895.HBHAL_3657Conserved hypothetical protein.
rplU protein networkhttps://string-db.org/network/866895.HBHAL_365850S ribosomal protein L21; This protein binds to 23S rRNA in the presence of protein L20; Belongs to the bacterial ribosomal protein bL21 family.
CCG46004.1 protein networkhttps://string-db.org/network/866895.HBHAL_3659Ribonuclease, Rne/Rng family.
CCG46005.1 protein networkhttps://string-db.org/network/866895.HBHAL_3660Stage IV sporulation protein FB.
CCG46006.1 protein networkhttps://string-db.org/network/866895.HBHAL_3661Stage IV sporulation protein FA.
minD protein networkhttps://string-db.org/network/866895.HBHAL_3662Septum site-determining protein MinD.
minC protein networkhttps://string-db.org/network/866895.HBHAL_3663Septum formation inhibitor; Cell division inhibitor that blocks the formation of polar Z ring septums. Rapidly oscillates between the poles of the cell to destabilize FtsZ filaments that have for [...]
mreD protein networkhttps://string-db.org/network/866895.HBHAL_3664Cell-shape determining protein.
mreC protein networkhttps://string-db.org/network/866895.HBHAL_3665Rod shape-determining protein MreC; Involved in formation and maintenance of cell shape.
mreB1 protein networkhttps://string-db.org/network/866895.HBHAL_3666Rod shape-determining protein MreB.
radC protein networkhttps://string-db.org/network/866895.HBHAL_3667DNA repair protein RadC; Belongs to the UPF0758 family.
maf protein networkhttps://string-db.org/network/866895.HBHAL_3668Maf-like protein; Nucleoside triphosphate pyrophosphatase that hydrolyzes dTTP and UTP. May have a dual role in cell division arrest and in preventing the incorporation of modified nucleotides in [...]
CCG46014.1 protein networkhttps://string-db.org/network/866895.HBHAL_3669Conserved hypothetical protein.
comC protein networkhttps://string-db.org/network/866895.HBHAL_3670ComC.
CCG46016.1 protein networkhttps://string-db.org/network/866895.HBHAL_3671Diguanylate cyclase domain protein.
CCG46017.1 protein networkhttps://string-db.org/network/866895.HBHAL_3672Folylpolyglutamate synthase; Belongs to the folylpolyglutamate synthase family.
valS protein networkhttps://string-db.org/network/866895.HBHAL_3673valyl-tRNA synthetase; Catalyzes the attachment of valine to tRNA(Val). As ValRS can inadvertently accommodate and process structurally similar amino acids such as threonine, to avoid such errors [...]
CCG46019.1 protein networkhttps://string-db.org/network/866895.HBHAL_3674Hypothetical protein.
CCG46020.1 protein networkhttps://string-db.org/network/866895.HBHAL_3675Stage VI sporulation protein D.
hemL-3 protein networkhttps://string-db.org/network/866895.HBHAL_3676Glutamate-1-semialdehyde aminotransferase.
hemB protein networkhttps://string-db.org/network/866895.HBHAL_3677Delta-aminolevulinic acid dehydratase; Belongs to the ALAD family.
hemD protein networkhttps://string-db.org/network/866895.HBHAL_3678uroporphyrinogen-III synthase; Catalyzes cyclization of the linear tetrapyrrole, hydroxymethylbilane, to the macrocyclic uroporphyrinogen III.
hemC protein networkhttps://string-db.org/network/866895.HBHAL_3679Porphobilinogen deaminase; Tetrapolymerization of the monopyrrole PBG into the hydroxymethylbilane pre-uroporphyrinogen in several discrete steps. Belongs to the HMBS family.
hemX protein networkhttps://string-db.org/network/866895.HBHAL_3680HemX protein.
hemA protein networkhttps://string-db.org/network/866895.HBHAL_3681glutamyl-tRNA reductase; Catalyzes the NADPH-dependent reduction of glutamyl-tRNA(Glu) to glutamate 1-semialdehyde (GSA).
CCG46027.1 protein networkhttps://string-db.org/network/866895.HBHAL_3681_AConserved hypothetical protein.
CCG46028.1 protein networkhttps://string-db.org/network/866895.HBHAL_3682ABC-type transport system ATP-binding protein (probable substrate polar amino acid).
CCG46029.1 protein networkhttps://string-db.org/network/866895.HBHAL_3683ABC-type transport system permease protein (probable substrate polar amino acid).
CCG46030.1 protein networkhttps://string-db.org/network/866895.HBHAL_3684ABC-type transport system extracellular binding protein (probable substrate polar amino acid); Belongs to the bacterial solute-binding protein 3 family.
engB protein networkhttps://string-db.org/network/866895.HBHAL_3685GTPase EngB; Necessary for normal cell division and for the maintenance of normal septation; Belongs to the TRAFAC class TrmE-Era-EngA-EngB-Septin-like GTPase superfamily. EngB GTPase family.
lon protein networkhttps://string-db.org/network/866895.HBHAL_3686ATP-dependent protease La; ATP-dependent serine protease that mediates the selective degradation of mutant and abnormal proteins as well as certain short- lived regulatory proteins. Required for [...]
clpX protein networkhttps://string-db.org/network/866895.HBHAL_3687ATP-dependent Clp protease ATP-binding subunit; ATP-dependent specificity component of the Clp protease. It directs the protease to specific substrates. Can perform chaperone functions in the abs [...]
tig protein networkhttps://string-db.org/network/866895.HBHAL_3688Trigger factor; Involved in protein export. Acts as a chaperone by maintaining the newly synthesized protein in an open conformation. Functions as a peptidyl-prolyl cis-trans isomerase; Belongs t [...]
ysoA protein networkhttps://string-db.org/network/866895.HBHAL_3689Hypothetical protein.
CCG46037.1 protein networkhttps://string-db.org/network/866895.HBHAL_3692IS150-type transposase orfAB.
CCG46038.1 protein networkhttps://string-db.org/network/866895.HBHAL_3693Hypothetical protein.
qoxD protein networkhttps://string-db.org/network/866895.HBHAL_3694Cytochrome aa3 quinol oxidase subunit IV.
qoxC protein networkhttps://string-db.org/network/866895.HBHAL_3695Cytochrome aa3 quinol oxidase subunit III.
qoxB protein networkhttps://string-db.org/network/866895.HBHAL_3696Cytochrome aa3 quinol oxidase subunit I.
qoxA protein networkhttps://string-db.org/network/866895.HBHAL_3697Cytochrome aa3 quinol oxidase subunit II; Catalyzes quinol oxidation with the concomitant reduction of oxygen to water. Subunit II transfers the electrons from a quinol to the binuclear center of [...]
CCG46043.1 protein networkhttps://string-db.org/network/866895.HBHAL_3698Hypothetical protein.
ywaD protein networkhttps://string-db.org/network/866895.HBHAL_3699Aminopeptidase.
CCG46045.1 protein networkhttps://string-db.org/network/866895.HBHAL_3700Putative phosphodiesterase.
CCG46046.1 protein networkhttps://string-db.org/network/866895.HBHAL_3701Putative nucleoside-triphosphatase; Pyrophosphatase that catalyzes the hydrolysis of nucleoside triphosphates to their monophosphate derivatives, with a high preference for the non-canonical puri [...]
rph protein networkhttps://string-db.org/network/866895.HBHAL_3702Ribonuclease PH; Phosphorolytic 3'-5' exoribonuclease that plays an important role in tRNA 3'-end maturation. Removes nucleotide residues following the 3'-CCA terminus of tRNAs; can also add nucl [...]
gerM protein networkhttps://string-db.org/network/866895.HBHAL_3703Spore germination protein GerM.
racE protein networkhttps://string-db.org/network/866895.HBHAL_3704Glutamate racemase; Provides the (R)-glutamate required for cell wall biosynthesis.
ysmB protein networkhttps://string-db.org/network/866895.HBHAL_3705MarR family transcription regulator.
CCG46051.1 protein networkhttps://string-db.org/network/866895.HBHAL_3706LuxR family transcription regulator.
CCG46052.1 protein networkhttps://string-db.org/network/866895.HBHAL_3707Two-component response regulator.
CCG46053.1 protein networkhttps://string-db.org/network/866895.HBHAL_3708Two-component sensor histidine kinase.
CCG46054.1 protein networkhttps://string-db.org/network/866895.HBHAL_3709Homolog to comP protein N-terminal domain.
sdhB protein networkhttps://string-db.org/network/866895.HBHAL_3710Succinate dehydrogenase iron-sulfur subunit.
sdhA protein networkhttps://string-db.org/network/866895.HBHAL_3711Succinate dehydrogenase flavoprotein subunit.
sdhC protein networkhttps://string-db.org/network/866895.HBHAL_3712Succinate dehydrogenase cytochrome b558 subunit.
CCG46058.1 protein networkhttps://string-db.org/network/866895.HBHAL_3713Conserved hypothetical protein.
uvrC protein networkhttps://string-db.org/network/866895.HBHAL_3714Excinuclease ABC subunit C; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsib [...]
trxA1 protein networkhttps://string-db.org/network/866895.HBHAL_3715Thioredoxin; Belongs to the thioredoxin family.
etfA protein networkhttps://string-db.org/network/866895.HBHAL_3716Electron transfer flavoprotein alpha subunit.
etfB protein networkhttps://string-db.org/network/866895.HBHAL_3717Electron transfer flavoprotein beta subunit.
CCG46063.1 protein networkhttps://string-db.org/network/866895.HBHAL_3718enoyl-CoA hydratase; Belongs to the enoyl-CoA hydratase/isomerase family.
fadR protein networkhttps://string-db.org/network/866895.HBHAL_3719TetR family transcription regulator.
lcfA protein networkhttps://string-db.org/network/866895.HBHAL_3720long-chain-fatty-acid--CoA ligase.
yshE1 protein networkhttps://string-db.org/network/866895.HBHAL_3721UPF0719 family protein.
mutS2 protein networkhttps://string-db.org/network/866895.HBHAL_3722DNA mismatch repair protein MutS; Endonuclease that is involved in the suppression of homologous recombination and may therefore have a key role in the control of bacterial genetic diversity; Bel [...]
polX protein networkhttps://string-db.org/network/866895.HBHAL_3723DNA polymerase PolX.
yshB protein networkhttps://string-db.org/network/866895.HBHAL_3725Conserved hypothetical protein.
CCG46071.1 protein networkhttps://string-db.org/network/866895.HBHAL_3726Conserved hypothetical protein; Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the forma [...]
rnhC protein networkhttps://string-db.org/network/866895.HBHAL_3727Ribonuclease HIII; Endonuclease that specifically degrades the RNA of RNA-DNA hybrids.
pheT protein networkhttps://string-db.org/network/866895.HBHAL_3728phenylalanyl-tRNA synthetase beta subunit; Belongs to the phenylalanyl-tRNA synthetase beta subunit family. Type 1 subfamily.
pheS protein networkhttps://string-db.org/network/866895.HBHAL_3729phenylalanyl-tRNA synthetase alpha subunit; Belongs to the class-II aminoacyl-tRNA synthetase family. Phe-tRNA synthetase alpha subunit type 1 subfamily.
CCG46075.1 protein networkhttps://string-db.org/network/866895.HBHAL_3730RNA methyltransferase; Belongs to the class IV-like SAM-binding methyltransferase superfamily. RNA methyltransferase TrmH family.
sspI protein networkhttps://string-db.org/network/866895.HBHAL_3731Small acid-soluble spore protein; Belongs to the SspI family.
yhfE protein networkhttps://string-db.org/network/866895.HBHAL_3732M42 family peptidase.
CCG46078.1 protein networkhttps://string-db.org/network/866895.HBHAL_3733Hypothetical protein.
ysdB protein networkhttps://string-db.org/network/866895.HBHAL_3734Hypothetical protein.
CCG46081.1 protein networkhttps://string-db.org/network/866895.HBHAL_3736DedA family protein.
CCG46082.1 protein networkhttps://string-db.org/network/866895.HBHAL_3737Hypothetical protein.
rplT protein networkhttps://string-db.org/network/866895.HBHAL_373850S ribosomal protein L20; Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing func [...]
rpmI protein networkhttps://string-db.org/network/866895.HBHAL_373950S ribosomal protein L35; Belongs to the bacterial ribosomal protein bL35 family.
infC protein networkhttps://string-db.org/network/866895.HBHAL_3740Translation initiation factor IF-3; IF-3 binds to the 30S ribosomal subunit and shifts the equilibrum between 70S ribosomes and their 50S and 30S subunits in favor of the free subunits, thus enha [...]
thrS protein networkhttps://string-db.org/network/866895.HBHAL_3741threonyl-tRNA synthetase; Catalyzes the attachment of threonine to tRNA(Thr) in a two- step reaction: L-threonine is first activated by ATP to form Thr-AMP and then transferred to the acceptor en [...]
CCG46087.1 protein networkhttps://string-db.org/network/866895.HBHAL_3742Hypothetical protein.
CCG46088.1 protein networkhttps://string-db.org/network/866895.HBHAL_3743Conserved hypothetical protein.
dnaI protein networkhttps://string-db.org/network/866895.HBHAL_3744Primosomal protein DnaI.
dnaB protein networkhttps://string-db.org/network/866895.HBHAL_3745DNA replication protein DnaB.
nrdR protein networkhttps://string-db.org/network/866895.HBHAL_3746Transcription regulator NrdR; Negatively regulates transcription of bacterial ribonucleotide reductase nrd genes and operons by binding to NrdR- boxes; Belongs to the NrdR family.
CCG46092.1 protein networkhttps://string-db.org/network/866895.HBHAL_3747Hypothetical protein.
speH protein networkhttps://string-db.org/network/866895.HBHAL_3748S-adenosylmethionine decarboxylase; Catalyzes the decarboxylation of S-adenosylmethionine to S- adenosylmethioninamine (dcAdoMet), the propylamine donor required for the synthesis of the polyamin [...]
gapB protein networkhttps://string-db.org/network/866895.HBHAL_3749Glyceraldehyde-3-phosphate dehydrogenase; Belongs to the glyceraldehyde-3-phosphate dehydrogenase family.
coaE protein networkhttps://string-db.org/network/866895.HBHAL_3750dephospho-CoA kinase; Catalyzes the phosphorylation of the 3'-hydroxyl group of dephosphocoenzyme A to form coenzyme A; Belongs to the CoaE family.
CCG46096.1 protein networkhttps://string-db.org/network/866895.HBHAL_3751Conserved hypothetical protein; Probably functions as a manganese efflux pump.
mutM protein networkhttps://string-db.org/network/866895.HBHAL_3752formamidopyrimidine-DNA glycosylase; Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a [...]
polA protein networkhttps://string-db.org/network/866895.HBHAL_3753DNA polymerase I; In addition to polymerase activity, this DNA polymerase exhibits 5'-3' exonuclease activity.
CCG46099.1 protein networkhttps://string-db.org/network/866895.HBHAL_3754Two-component sensor histidine kinase.
CCG46100.1 protein networkhttps://string-db.org/network/866895.HBHAL_3755Two-component response regulator.
CCG46101.1 protein networkhttps://string-db.org/network/866895.HBHAL_3756MaoC family protein.
mdh protein networkhttps://string-db.org/network/866895.HBHAL_3757Malate dehydrogenase; Catalyzes the reversible oxidation of malate to oxaloacetate. Belongs to the LDH/MDH superfamily. MDH type 3 family.
citC protein networkhttps://string-db.org/network/866895.HBHAL_3758Isocitrate dehydrogenase.
citZ protein networkhttps://string-db.org/network/866895.HBHAL_3759Methylcitrate synthase; Belongs to the citrate synthase family.
CCG46105.1 protein networkhttps://string-db.org/network/866895.HBHAL_3760UPF0118 family protein.
fxsA protein networkhttps://string-db.org/network/866895.HBHAL_3761FxsA protein.
pykA protein networkhttps://string-db.org/network/866895.HBHAL_3762Pyruvate kinase; Belongs to the pyruvate kinase family.
pfkA2 protein networkhttps://string-db.org/network/866895.HBHAL_37636-phosphofructokinase; Catalyzes the phosphorylation of D-fructose 6-phosphate to fructose 1,6-bisphosphate by ATP, the first committing step of glycolysis.
accA protein networkhttps://string-db.org/network/866895.HBHAL_3764acetyl-CoA carboxylase carboxyltransferase subunit alpha; Component of the acetyl coenzyme A carboxylase (ACC) complex. First, biotin carboxylase catalyzes the carboxylation of biotin on its carr [...]
accD protein networkhttps://string-db.org/network/866895.HBHAL_3765acetyl-CoA carboxylase carboxyltransferase subunit beta; Component of the acetyl coenzyme A carboxylase (ACC) complex. Biotin carboxylase (BC) catalyzes the carboxylation of biotin on its carrier [...]
CCG46111.1 protein networkhttps://string-db.org/network/866895.HBHAL_3766GntR family transcription regulator.
CCG46112.1 protein networkhttps://string-db.org/network/866895.HBHAL_3767Malate dehydrogenase (oxaloacetate-decarboxylating).
dnaE protein networkhttps://string-db.org/network/866895.HBHAL_3768DNA polymerase III alpha subunit.
ytrH protein networkhttps://string-db.org/network/866895.HBHAL_3769Hypothetical protein.
ytrI protein networkhttps://string-db.org/network/866895.HBHAL_3770Hypothetical protein.
ytqI protein networkhttps://string-db.org/network/866895.HBHAL_3771DHH family phosphoesterase.
CCG46117.1 protein networkhttps://string-db.org/network/866895.HBHAL_3772Hypothetical protein.
CCG46118.1 protein networkhttps://string-db.org/network/866895.HBHAL_3773Thioesterase family protein.
ytkL protein networkhttps://string-db.org/network/866895.HBHAL_3774Metal-dependent hydrolase; Belongs to the UPF0173 family.
speE1 protein networkhttps://string-db.org/network/866895.HBHAL_3775Spermidine synthase; Catalyzes the irreversible transfer of a propylamine group from the amino donor S-adenosylmethioninamine (decarboxy-AdoMet) to putrescine (1,4-diaminobutane) to yield spermid [...]
yshE2 protein networkhttps://string-db.org/network/866895.HBHAL_3776UPF0719 family protein.
CCG46122.1 protein networkhttps://string-db.org/network/866895.HBHAL_3777Hypothetical protein.
pspA protein networkhttps://string-db.org/network/866895.HBHAL_3778Hypothetical protein.
CCG46124.1 protein networkhttps://string-db.org/network/866895.HBHAL_3779Conserved hypothetical protein.
CCG46125.1 protein networkhttps://string-db.org/network/866895.HBHAL_3780Bile acid/sodium symporter (BASS) family protein.
ald2 protein networkhttps://string-db.org/network/866895.HBHAL_3781Alanine dehydrogenase; Belongs to the AlaDH/PNT family.
CCG46127.1 protein networkhttps://string-db.org/network/866895.HBHAL_37823-oxoacyl-[acyl-carrier-protein] reductase.
CCG46128.1 protein networkhttps://string-db.org/network/866895.HBHAL_3783Nucleobase/cation symporter-1 family protein.
CCG46129.1 protein networkhttps://string-db.org/network/866895.HBHAL_3784Hypothetical protein.
uspA5 protein networkhttps://string-db.org/network/866895.HBHAL_3785UspA domain protein.
moaB protein networkhttps://string-db.org/network/866895.HBHAL_3786Molybdenum cofactor biosynthesis protein MoaB; May be involved in the biosynthesis of molybdopterin. Belongs to the MoaB/Mog family.
CCG46132.1 protein networkhttps://string-db.org/network/866895.HBHAL_3787Hypothetical protein.
ackA protein networkhttps://string-db.org/network/866895.HBHAL_3788Acetate kinase; Catalyzes the formation of acetyl phosphate from acetate and ATP. Can also catalyze the reverse reaction; Belongs to the acetokinase family.
CCG46134.1 protein networkhttps://string-db.org/network/866895.HBHAL_3789Putative DNA-methyltransferase.
ppnK2 protein networkhttps://string-db.org/network/866895.HBHAL_3790Inorganic polyphosphate/ATP-NAD kinase; Involved in the regulation of the intracellular balance of NAD and NADP, and is a key enzyme in the biosynthesis of NADP. Catalyzes specifically the phosph [...]
CCG46136.1 protein networkhttps://string-db.org/network/866895.HBHAL_3791Amidohydrolase family protein.
thiI protein networkhttps://string-db.org/network/866895.HBHAL_3792Thiamine biosynthesis protein ThiI; Catalyzes the ATP-dependent transfer of a sulfur to tRNA to produce 4-thiouridine in position 8 of tRNAs, which functions as a near-UV photosensor. Also cataly [...]
CCG46138.1 protein networkhttps://string-db.org/network/866895.HBHAL_3793Aminotransferase.
CCG46139.1 protein networkhttps://string-db.org/network/866895.HBHAL_3794Hypothetical protein.
ezrA protein networkhttps://string-db.org/network/866895.HBHAL_3795Septation ring formation regulator; Negative regulator of FtsZ ring formation; modulates the frequency and position of FtsZ ring formation. Inhibits FtsZ ring formation at polar sites. Interacts [...]
hisJ1 protein networkhttps://string-db.org/network/866895.HBHAL_3796Histidinol-phosphatase; Belongs to the PHP hydrolase family. HisK subfamily.
CCG46142.1 protein networkhttps://string-db.org/network/866895.HBHAL_3797TetR family transcription regulator.
ytsP protein networkhttps://string-db.org/network/866895.HBHAL_3798GAF domain protein.
rpsD protein networkhttps://string-db.org/network/866895.HBHAL_3801Diguanylate cyclase domain protein (nonfunctional); One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the body of the 30S subunit.
CCG46146.1 protein networkhttps://string-db.org/network/866895.HBHAL_3802Conserved hypothetical protein.
tyrS protein networkhttps://string-db.org/network/866895.HBHAL_3803tyrosyl-tRNA synthetase; Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two- step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of [...]
CCG46148.1 protein networkhttps://string-db.org/network/866895.HBHAL_3804Penicillin binding protein.
acuA protein networkhttps://string-db.org/network/866895.HBHAL_3805Acetoin utilization protein.
acuB protein networkhttps://string-db.org/network/866895.HBHAL_3806Acetoin utilization protein AcuB.
acuC protein networkhttps://string-db.org/network/866895.HBHAL_3807Acetoin utilization protein AcuC.
motS protein networkhttps://string-db.org/network/866895.HBHAL_3808Flagellar motor protein MotS.
motP protein networkhttps://string-db.org/network/866895.HBHAL_3809Flagellar motor protein MotP.
ccpA protein networkhttps://string-db.org/network/866895.HBHAL_3810Catabolite control protein A.
aroG protein networkhttps://string-db.org/network/866895.HBHAL_3811Bifunctional 3-deoxy-7-phosphoheptulonate synthase / chorismate mutase.
ytxJ1 protein networkhttps://string-db.org/network/866895.HBHAL_3812Conserved hypothetical protein.
CCG46157.1 protein networkhttps://string-db.org/network/866895.HBHAL_3813Conserved hypothetical protein.
ytxG1 protein networkhttps://string-db.org/network/866895.HBHAL_3814UPF0478 family protein.
murC protein networkhttps://string-db.org/network/866895.HBHAL_3815UDP-N-acetylmuramate--L-alanine ligase; Cell wall formation; Belongs to the MurCDEF family.
pncB protein networkhttps://string-db.org/network/866895.HBHAL_3816Nicotinate phosphoribosyltransferase; Belongs to the NAPRTase family.
sftA protein networkhttps://string-db.org/network/866895.HBHAL_3817DNA translocase SftA; Belongs to the FtsK/SpoIIIE/SftA family.
ytpR protein networkhttps://string-db.org/network/866895.HBHAL_3818Conserved hypothetical protein; Belongs to the phenylalanyl-tRNA synthetase beta subunit family. Type 1 subfamily.
ytpQ protein networkhttps://string-db.org/network/866895.HBHAL_3819Hypothetical protein; Belongs to the UPF0354 family.
trxA3 protein networkhttps://string-db.org/network/866895.HBHAL_3820Thioredoxin.
CCG46165.1 protein networkhttps://string-db.org/network/866895.HBHAL_3821Conserved hypothetical protein.
CCG46166.1 protein networkhttps://string-db.org/network/866895.HBHAL_3822Hypothetical protein.
ytoQ protein networkhttps://string-db.org/network/866895.HBHAL_3823Hypothetical protein.
yjjX protein networkhttps://string-db.org/network/866895.HBHAL_3824NTPase; Phosphatase that hydrolyzes non-canonical purine nucleotides such as XTP and ITP to their respective diphosphate derivatives. Probably excludes non-canonical purines from DNA/RNA precurso [...]
ytoP protein networkhttps://string-db.org/network/866895.HBHAL_3825Deblocking aminopeptidase, M42 family.
ytzB protein networkhttps://string-db.org/network/866895.HBHAL_3826Hypothetical protein.
CCG46171.1 protein networkhttps://string-db.org/network/866895.HBHAL_3827Metal-dependent hydrolase.
trmB protein networkhttps://string-db.org/network/866895.HBHAL_3828tRNA (guanine-N(7)-)-methyltransferase; Catalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.
CCG46173.1 protein networkhttps://string-db.org/network/866895.HBHAL_3829Hypothetical protein.
ytmP protein networkhttps://string-db.org/network/866895.HBHAL_3830Aminoglycoside phosphotransferase family protein.
CCG46175.1 protein networkhttps://string-db.org/network/866895.HBHAL_3831Probable lipid kinase (homolog to diacylglycerol kinase).
CCG46176.1 protein networkhttps://string-db.org/network/866895.HBHAL_3832Diguanylate phosphodiesterase domain protein.
ytlQ protein networkhttps://string-db.org/network/866895.HBHAL_3833Hypothetical protein.
ytlP protein networkhttps://string-db.org/network/866895.HBHAL_38342'-5' RNA ligase family protein, putative; Hydrolyzes RNA 2',3'-cyclic phosphodiester to an RNA 2'- phosphomonoester; Belongs to the 2H phosphoesterase superfamily. ThpR family.
CCG46179.1 protein networkhttps://string-db.org/network/866895.HBHAL_3835MFS-type transporter (probable substrate maltose).
ytjP protein networkhttps://string-db.org/network/866895.HBHAL_3836Xaa-His dipeptidase.
CCG46181.1 protein networkhttps://string-db.org/network/866895.HBHAL_3837Potassium channel protein.
CCG46182.1 protein networkhttps://string-db.org/network/866895.HBHAL_3838Pseudouridine synthase; Belongs to the pseudouridine synthase RsuA family.
CCG46183.1 protein networkhttps://string-db.org/network/866895.HBHAL_3839Spore cortex protein.
ytfP protein networkhttps://string-db.org/network/866895.HBHAL_3840Conserved hypothetical protein.
CCG46186.1 protein networkhttps://string-db.org/network/866895.HBHAL_3842Hypothetical protein.
CCG46187.1 protein networkhttps://string-db.org/network/866895.HBHAL_3844Hypothetical protein.
CCG46188.1 protein networkhttps://string-db.org/network/866895.HBHAL_3845Rhodanese domain protein.
leuS protein networkhttps://string-db.org/network/866895.HBHAL_3846leucyl-tRNA synthetase; Belongs to the class-I aminoacyl-tRNA synthetase family.
CCG46190.1 protein networkhttps://string-db.org/network/866895.HBHAL_3847Hypothetical protein.
CCG46191.1 protein networkhttps://string-db.org/network/866895.HBHAL_3848Hypothetical protein.
ytqB protein networkhttps://string-db.org/network/866895.HBHAL_3849Probable rRNA methylase YtqB.
ytpB protein networkhttps://string-db.org/network/866895.HBHAL_3850Hypothetical protein.
ytpA protein networkhttps://string-db.org/network/866895.HBHAL_3851Alpha/beta fold hydrolase.
ytoA protein networkhttps://string-db.org/network/866895.HBHAL_3852Bacterial transferase family protein.
metK protein networkhttps://string-db.org/network/866895.HBHAL_3853S-adenosylmethionine synthetase; Catalyzes the formation of S-adenosylmethionine (AdoMet) from methionine and ATP. The overall synthetic reaction is composed of two sequential steps, AdoMet forma [...]
CCG46197.1 protein networkhttps://string-db.org/network/866895.HBHAL_3854Hypothetical protein.
pckA protein networkhttps://string-db.org/network/866895.HBHAL_3855Phosphoenolpyruvate carboxykinase; Involved in the gluconeogenesis. Catalyzes the conversion of oxaloacetate (OAA) to phosphoenolpyruvate (PEP) through direct phosphoryl transfer between the nucl [...]
ytkD protein networkhttps://string-db.org/network/866895.HBHAL_38568-oxo-dGTP diphosphatase YtkD; Belongs to the Nudix hydrolase family.
CCG46200.1 protein networkhttps://string-db.org/network/866895.HBHAL_3857Hypothetical protein.
CCG46201.1 protein networkhttps://string-db.org/network/866895.HBHAL_3858Hypothetical protein.
menC protein networkhttps://string-db.org/network/866895.HBHAL_3859O-succinylbenzoate-CoA synthase; Converts 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1- carboxylate (SHCHC) to 2-succinylbenzoate (OSB).
menE protein networkhttps://string-db.org/network/866895.HBHAL_3860O-succinylbenzoic acid--CoA ligase; Converts 2-succinylbenzoate (OSB) to 2-succinylbenzoyl-CoA (OSB-CoA); Belongs to the ATP-dependent AMP-binding enzyme family. MenE subfamily.
menB protein networkhttps://string-db.org/network/866895.HBHAL_3861Naphthoate synthase; Converts o-succinylbenzoyl-CoA (OSB-CoA) to 1,4-dihydroxy-2- naphthoyl-CoA (DHNA-CoA).
menH protein networkhttps://string-db.org/network/866895.HBHAL_38622-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase; Catalyzes a proton abstraction reaction that results in 2,5- elimination of pyruvate from 2-succinyl-5-enolpyruvyl-6-hydroxy-3- cy [...]
menD protein networkhttps://string-db.org/network/866895.HBHAL_38632-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase; Catalyzes the thiamine diphosphate-dependent decarboxylation of 2-oxoglutarate and the subsequent [...]
menF protein networkhttps://string-db.org/network/866895.HBHAL_3864Menaquinone-specific isochorismate synthase; Catalyzes the conversion of chorismate to isochorismate.
CCG46208.1 protein networkhttps://string-db.org/network/866895.HBHAL_3865Hypothetical protein.
menA protein networkhttps://string-db.org/network/866895.HBHAL_38661,4-dihydroxy-2-naphthoateoctaprenyltransferase; Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to demethylmenaquinone (DMK); Belongs to the MenA family. Type 1 subfamily.
yuxO protein networkhttps://string-db.org/network/866895.HBHAL_3867Thioesterase family protein.
CCG46211.1 protein networkhttps://string-db.org/network/866895.HBHAL_3868Conserved hypothetical protein.
ypaA protein networkhttps://string-db.org/network/866895.HBHAL_3869Hypothetical protein; Mediates riboflavin uptake, may also transport FMN and roseoflavin. Probably a riboflavin-binding protein that interacts with the energy-coupling factor (ECF) ABC-transporte [...]
CCG46213.1 protein networkhttps://string-db.org/network/866895.HBHAL_3870Hypothetical protein.
CCG46214.1 protein networkhttps://string-db.org/network/866895.HBHAL_3872Conserved hypothetical protein.
amiC protein networkhttps://string-db.org/network/866895.HBHAL_3874N-acetylmuramoyl-L-alanine amidase.
CCG46217.1 protein networkhttps://string-db.org/network/866895.HBHAL_3875Conserved hypothetical protein.
CCG46218.1 protein networkhttps://string-db.org/network/866895.HBHAL_3876Conserved hypothetical protein.
CCG46219.1 protein networkhttps://string-db.org/network/866895.HBHAL_3877Acetyltransferase, GNAT family.
CCG46220.1 protein networkhttps://string-db.org/network/866895.HBHAL_3878Hypothetical protein.
CCG46221.1 protein networkhttps://string-db.org/network/866895.HBHAL_3879Endoglucanase.
CCG46222.1 protein networkhttps://string-db.org/network/866895.HBHAL_3880Hypothetical protein.
CCG46223.1 protein networkhttps://string-db.org/network/866895.HBHAL_3881Potassium channel protein.
yugN protein networkhttps://string-db.org/network/866895.HBHAL_3882Hypothetical protein.
pgi protein networkhttps://string-db.org/network/866895.HBHAL_3883Glucose-6-phosphate isomerase; Belongs to the GPI family.
CCG46227.1 protein networkhttps://string-db.org/network/866895.HBHAL_3885Alcohol dehydrogenase.
yuzA protein networkhttps://string-db.org/network/866895.HBHAL_3886Conserved hypothetical protein.
yugI protein networkhttps://string-db.org/network/866895.HBHAL_3887General stress protein YugI.
CCG46230.1 protein networkhttps://string-db.org/network/866895.HBHAL_3888SinR/xre family transcription regulator.
patB protein networkhttps://string-db.org/network/866895.HBHAL_3889Cystathionine beta-lyase PatB.
sodC3 protein networkhttps://string-db.org/network/866895.HBHAL_3890Superoxide dismutase (Cu/Zn); Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Belongs to the Cu-Zn superoxide dismutase family.
CCG46233.1 protein networkhttps://string-db.org/network/866895.HBHAL_3891Hypothetical protein.
kapB protein networkhttps://string-db.org/network/866895.HBHAL_3892Kinase-associated protein KapB.
CCG46235.1 protein networkhttps://string-db.org/network/866895.HBHAL_3893Na+/H+ antiporter family protein.
yhaT protein networkhttps://string-db.org/network/866895.HBHAL_3894TrkA-C domain protein.
deoD protein networkhttps://string-db.org/network/866895.HBHAL_3895Purine nucleoside phosphorylase.
CCG46238.1 protein networkhttps://string-db.org/network/866895.HBHAL_3896Hypothetical protein.
yuiD1 protein networkhttps://string-db.org/network/866895.HBHAL_3897Conserved hypothetical protein.
yuiC protein networkhttps://string-db.org/network/866895.HBHAL_3898Conserved hypothetical protein.
yuiB protein networkhttps://string-db.org/network/866895.HBHAL_3899Conserved hypothetical protein.
CCG46243.1 protein networkhttps://string-db.org/network/866895.HBHAL_3901NADH dehydrogenase.
CCG46244.1 protein networkhttps://string-db.org/network/866895.HBHAL_3902ferredoxin--NADP reductase.
CCG46245.1 protein networkhttps://string-db.org/network/866895.HBHAL_3903Hypothetical protein.
yutM protein networkhttps://string-db.org/network/866895.HBHAL_3904Hypothetical protein; Belongs to the HesB/IscA family.
CCG46247.1 protein networkhttps://string-db.org/network/866895.HBHAL_3905Hypothetical protein.
CCG46248.1 protein networkhttps://string-db.org/network/866895.HBHAL_3906UPF0349 family protein.
CCG46249.1 protein networkhttps://string-db.org/network/866895.HBHAL_3907Conserved hypothetical protein.
CCG46250.1 protein networkhttps://string-db.org/network/866895.HBHAL_3908Hypothetical protein.
yutI protein networkhttps://string-db.org/network/866895.HBHAL_3909Conserved hypothetical protein.
CCG46252.1 protein networkhttps://string-db.org/network/866895.HBHAL_3910Probable 2-hydroxyacid dehydrogenase (NAD); Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
yutG protein networkhttps://string-db.org/network/866895.HBHAL_3911Low temperature requirement C protein.
CCG46254.1 protein networkhttps://string-db.org/network/866895.HBHAL_3912Hypothetical protein.
CCG46255.1 protein networkhttps://string-db.org/network/866895.HBHAL_3913HAD superfamily hydrolase; Catalyzes the dephosphorylation of 2-6 carbon acid sugars in vitro; Belongs to the HAD-like hydrolase superfamily. NagD family.
yutE protein networkhttps://string-db.org/network/866895.HBHAL_3914Hypothetical protein.
fbp2 protein networkhttps://string-db.org/network/866895.HBHAL_3915Fructose 1,6-bisphosphatase, class II.
CCG46258.1 protein networkhttps://string-db.org/network/866895.HBHAL_3916Hypothetical protein.
CCG46259.1 protein networkhttps://string-db.org/network/866895.HBHAL_3917Hypothetical protein.
yutD protein networkhttps://string-db.org/network/866895.HBHAL_3918Hypothetical protein.
CCG46261.1 protein networkhttps://string-db.org/network/866895.HBHAL_3919Conserved hypothetical protein.
yunA protein networkhttps://string-db.org/network/866895.HBHAL_3920Hypothetical protein.
CCG46264.1 protein networkhttps://string-db.org/network/866895.HBHAL_3922Sodium-dependent transporter family protein.
CCG46265.1 protein networkhttps://string-db.org/network/866895.HBHAL_3923Conserved hypothetical protein.
CCG46266.1 protein networkhttps://string-db.org/network/866895.HBHAL_3924Conserved hypothetical protein.
yunD protein networkhttps://string-db.org/network/866895.HBHAL_3925Probable metallophosphoesterase; Belongs to the 5'-nucleotidase family.
CCG46268.1 protein networkhttps://string-db.org/network/866895.HBHAL_3926UPF0721 family protein.
sufB protein networkhttps://string-db.org/network/866895.HBHAL_3927Fe-S cluster assembly protein SufB.
nifU protein networkhttps://string-db.org/network/866895.HBHAL_3928NifU family iron-sulfur cluster assembly protein.
CCG46271.1 protein networkhttps://string-db.org/network/866895.HBHAL_3929Cysteine desulfurase; Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family.
sufD protein networkhttps://string-db.org/network/866895.HBHAL_3930FeS cluster assembly protein SufD.
CCG46273.1 protein networkhttps://string-db.org/network/866895.HBHAL_3931ABC-type transport system ATP-binding protein.
CCG46274.1 protein networkhttps://string-db.org/network/866895.HBHAL_3932Hypothetical protein.
CCG46275.1 protein networkhttps://string-db.org/network/866895.HBHAL_3933Putative carboxymuconolactone decarboxylase.
metQ1 protein networkhttps://string-db.org/network/866895.HBHAL_3934ABC-type transport system extracellular binding protein (probable substrate methionine); Belongs to the nlpA lipoprotein family.
metP1 protein networkhttps://string-db.org/network/866895.HBHAL_3935ABC-type transport system permease protein (probable substrate methionine).
metN1 protein networkhttps://string-db.org/network/866895.HBHAL_3936ABC-type transport system ATP-binding protein (probable substrate methionine); Part of the ABC transporter complex MetNIQ involved in methionine import. Responsible for energy coupling to the tra [...]
CCG46279.1 protein networkhttps://string-db.org/network/866895.HBHAL_3937Thioredoxin.
yusE protein networkhttps://string-db.org/network/866895.HBHAL_3938Thioredoxin.
CCG46281.1 protein networkhttps://string-db.org/network/866895.HBHAL_3939Conserved hypothetical protein.
gcvH protein networkhttps://string-db.org/network/866895.HBHAL_3941Glycine cleavage system protein H; Is also involved in protein lipoylation via its role as an octanoyl/lipoyl carrier protein intermediate; Belongs to the GcvH family.
CCG46284.1 protein networkhttps://string-db.org/network/866895.HBHAL_3942MgsR/Spx family transcription regulator; Belongs to the ArsC family.
CCG46285.1 protein networkhttps://string-db.org/network/866895.HBHAL_3943acyl-CoA dehydrogenase.
CCG46286.1 protein networkhttps://string-db.org/network/866895.HBHAL_3944acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family.
CCG46287.1 protein networkhttps://string-db.org/network/866895.HBHAL_39453-hydroxyacyl-CoA dehydrogenase.
prodh1 protein networkhttps://string-db.org/network/866895.HBHAL_3946Proline dehydrogenase.
CCG46289.1 protein networkhttps://string-db.org/network/866895.HBHAL_3947Conserved hypothetical protein.
yusN protein networkhttps://string-db.org/network/866895.HBHAL_3948Hypothetical protein.
copZ1 protein networkhttps://string-db.org/network/866895.HBHAL_3949Copper chaperone CopZ.
CCG46293.1 protein networkhttps://string-db.org/network/866895.HBHAL_3951Hypothetical protein.
CCG46294.1 protein networkhttps://string-db.org/network/866895.HBHAL_3952Cobalamin-binding domain protein.
CCG46295.1 protein networkhttps://string-db.org/network/866895.HBHAL_3953Hypothetical protein.
CCG46296.1 protein networkhttps://string-db.org/network/866895.HBHAL_3954Hypothetical protein.
yocB protein networkhttps://string-db.org/network/866895.HBHAL_3955Conserved hypothetical protein.
CCG46298.1 protein networkhttps://string-db.org/network/866895.HBHAL_3956Hypothetical protein.
CCG46299.1 protein networkhttps://string-db.org/network/866895.HBHAL_3957Hypothetical protein.
moxR protein networkhttps://string-db.org/network/866895.HBHAL_3958MoxR family AAA-type ATPase.
CCG46301.1 protein networkhttps://string-db.org/network/866895.HBHAL_3959ABC-type transport system extracellular binding protein (probable substrate glycine betaine/proline).
CCG46302.1 protein networkhttps://string-db.org/network/866895.HBHAL_3960Hypothetical protein.
CCG46303.1 protein networkhttps://string-db.org/network/866895.HBHAL_3961MFS-type transporter (probable function chloramphenicol resistance).
CCG46304.1 protein networkhttps://string-db.org/network/866895.HBHAL_3962TrmB family transcription regulator.
CCG46306.1 protein networkhttps://string-db.org/network/866895.HBHAL_3964Hypothetical protein.
CCG46307.1 protein networkhttps://string-db.org/network/866895.HBHAL_3965Putative beta-ketoadipate enol-lactone hydrolase.
yrzF protein networkhttps://string-db.org/network/866895.HBHAL_3966Hypothetical protein.
CCG46309.1 protein networkhttps://string-db.org/network/866895.HBHAL_3967Small acid-soluble spore protein.
CCG46310.1 protein networkhttps://string-db.org/network/866895.HBHAL_3968Hypothetical protein.
CCG46311.1 protein networkhttps://string-db.org/network/866895.HBHAL_3969Hypothetical protein.
yoaI protein networkhttps://string-db.org/network/866895.HBHAL_39704-hydroxyphenylacetate-3-hydroxylase.
CCG46313.1 protein networkhttps://string-db.org/network/866895.HBHAL_3971Isocitrate lyase.
CCG46314.1 protein networkhttps://string-db.org/network/866895.HBHAL_3972Malate synthase; Belongs to the malate synthase family.
CCG46315.1 protein networkhttps://string-db.org/network/866895.HBHAL_3973Aldo/keto reductase family protein.
CCG46316.1 protein networkhttps://string-db.org/network/866895.HBHAL_3974Hypothetical protein.
CCG46317.1 protein networkhttps://string-db.org/network/866895.HBHAL_3975Phosphoglycerate mutase family protein.
ilvD protein networkhttps://string-db.org/network/866895.HBHAL_3976Dihydroxy-acid dehydratase; Belongs to the IlvD/Edd family.
murB protein networkhttps://string-db.org/network/866895.HBHAL_3977UDP-N-acetylenolpyruvoylglucosamine reductase; Cell wall formation.
CCG46320.1 protein networkhttps://string-db.org/network/866895.HBHAL_3978Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
ypjP protein networkhttps://string-db.org/network/866895.HBHAL_3979Hypothetical protein.
yhcQ protein networkhttps://string-db.org/network/866895.HBHAL_3980Hypothetical protein.
yqcI protein networkhttps://string-db.org/network/866895.HBHAL_3981Conserved hypothetical protein.
ykgA protein networkhttps://string-db.org/network/866895.HBHAL_3982Hypothetical protein.
dhaM protein networkhttps://string-db.org/network/866895.HBHAL_3983Dihydroxyacetone kinase phosphotransfer subunit.
dhaL protein networkhttps://string-db.org/network/866895.HBHAL_3984Dihydroxyacetone kinase subunit DhaL.
dhaK protein networkhttps://string-db.org/network/866895.HBHAL_3985Dihydroxyacetone kinase subunit DhaK.
glpK-2 protein networkhttps://string-db.org/network/866895.HBHAL_3986Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate; Belongs to the FGGY kinase family.
CCG46329.1 protein networkhttps://string-db.org/network/866895.HBHAL_3987MIP family channel protein (probable substrate glycerol); Belongs to the MIP/aquaporin (TC 1.A.8) family.
smpB protein networkhttps://string-db.org/network/866895.HBHAL_3988SsrA-binding protein; Required for rescue of stalled ribosomes mediated by trans- translation. Binds to transfer-messenger RNA (tmRNA), required for stable association of tmRNA with ribosomes. tm [...]
CCG46331.1 protein networkhttps://string-db.org/network/866895.HBHAL_3989Hypothetical protein.
rnr protein networkhttps://string-db.org/network/866895.HBHAL_3990Ribonuclease R; 3'-5' exoribonuclease that releases 5'-nucleoside monophosphates and is involved in maturation of structured RNAs.
est protein networkhttps://string-db.org/network/866895.HBHAL_3991Carboxylesterase.
secG protein networkhttps://string-db.org/network/866895.HBHAL_3992Preprotein translocase subunit SecG; Involved in protein export. Participates in an early event of protein translocation; Belongs to the SecG family.
CCG46335.1 protein networkhttps://string-db.org/network/866895.HBHAL_3993DeoR family transcription regulator.
CCG46336.1 protein networkhttps://string-db.org/network/866895.HBHAL_39941-phosphofructokinase; Belongs to the carbohydrate kinase PfkB family. LacC subfamily.
CCG46337.1 protein networkhttps://string-db.org/network/866895.HBHAL_3995PTS system subunit IIBC, fructose-specific.
CCG46338.1 protein networkhttps://string-db.org/network/866895.HBHAL_3996Phosphocarrier protein HPr.
CCG46339.1 protein networkhttps://string-db.org/network/866895.HBHAL_3997PTS system subunit I; General (non sugar-specific) component of the phosphoenolpyruvate-dependent sugar phosphotransferase system (sugar PTS). This major carbohydrate active-transport system cata [...]
CCG46340.1 protein networkhttps://string-db.org/network/866895.HBHAL_3998Hypothetical protein.
CCG46341.1 protein networkhttps://string-db.org/network/866895.HBHAL_3999Putative nitroreductase family protein.
CCG46342.1 protein networkhttps://string-db.org/network/866895.HBHAL_4000Hypothetical protein.
eno protein networkhttps://string-db.org/network/866895.HBHAL_4001Phosphopyruvate hydratase (enolase); Catalyzes the reversible conversion of 2-phosphoglycerate into phosphoenolpyruvate. It is essential for the degradation of carbohydrates via glycolysis; Belon [...]
gpmI protein networkhttps://string-db.org/network/866895.HBHAL_4002Phosphoglycerate mutase,2,3-bisphosphoglycerate-independent; Catalyzes the interconversion of 2-phosphoglycerate and 3- phosphoglycerate; Belongs to the BPG-independent phosphoglycerate mutase fa [...]
tpiA protein networkhttps://string-db.org/network/866895.HBHAL_4003Triosephosphate isomerase; Involved in the gluconeogenesis. Catalyzes stereospecifically the conversion of dihydroxyacetone phosphate (DHAP) to D- glyceraldehyde-3-phosphate (G3P); Belongs to the [...]
pgk protein networkhttps://string-db.org/network/866895.HBHAL_4004Phosphoglycerate kinase; Belongs to the phosphoglycerate kinase family.
gapA protein networkhttps://string-db.org/network/866895.HBHAL_4005Glyceraldehyde-3-phosphate dehydrogenase; Belongs to the glyceraldehyde-3-phosphate dehydrogenase family.
cggR protein networkhttps://string-db.org/network/866895.HBHAL_4006Transcription regulator CggR.
CCG46349.1 protein networkhttps://string-db.org/network/866895.HBHAL_4007Glutaredoxin.
CCG46350.1 protein networkhttps://string-db.org/network/866895.HBHAL_4008Hypothetical protein.
CCG46351.1 protein networkhttps://string-db.org/network/866895.HBHAL_4009IS1341-type transposase.
clpP protein networkhttps://string-db.org/network/866895.HBHAL_4011ATP-dependent Clp protease proteolytic subunit; Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degrada [...]
CCG46353.1 protein networkhttps://string-db.org/network/866895.HBHAL_4012PTS system phosphocarrier protein HPr.
whiA protein networkhttps://string-db.org/network/866895.HBHAL_4013Conserved hypothetical protein; Involved in cell division and chromosome segregation.
CCG46355.1 protein networkhttps://string-db.org/network/866895.HBHAL_4014UPF0052 family protein; Required for morphogenesis under gluconeogenic growth conditions; Belongs to the gluconeogenesis factor family.
CCG46356.1 protein networkhttps://string-db.org/network/866895.HBHAL_4015UPF0042 family nucleotide-binding protein; Displays ATPase and GTPase activities.
CCG46357.1 protein networkhttps://string-db.org/network/866895.HBHAL_4016MutT/NUDIX family protein.
CCG46358.1 protein networkhttps://string-db.org/network/866895.HBHAL_4017Thioredoxin-disulfide reductase.
yvcD protein networkhttps://string-db.org/network/866895.HBHAL_4018Hypothetical protein.
hisI protein networkhttps://string-db.org/network/866895.HBHAL_4019Bifunctional phosphoribosyl-ATP diphosphatase / phosphoribosyl-AMP cyclohydrolase; In the N-terminal section; belongs to the PRA-CH family.
hisF protein networkhttps://string-db.org/network/866895.HBHAL_4020Imidazoleglycerol-phosphate synthase subunit HisF; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisF subunit catalyzes the cyclization activity that produ [...]
hisA protein networkhttps://string-db.org/network/866895.HBHAL_40211-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide isomerase.
hisH protein networkhttps://string-db.org/network/866895.HBHAL_4022Imidazoleglycerol-phosphate synthase subunit HisH; IGPS catalyzes the conversion of PRFAR and glutamine to IGP, AICAR and glutamate. The HisH subunit catalyzes the hydrolysis of glutamine to glut [...]
hisB protein networkhttps://string-db.org/network/866895.HBHAL_4023Imidazoleglycerol-phosphate dehydratase.
hisD protein networkhttps://string-db.org/network/866895.HBHAL_4024Histidinol dehydrogenase; Catalyzes the sequential NAD-dependent oxidations of L- histidinol to L-histidinaldehyde and then to L-histidine.
hisG protein networkhttps://string-db.org/network/866895.HBHAL_4025ATP phosphoribosyltransferase; Catalyzes the condensation of ATP and 5-phosphoribose 1- diphosphate to form N'-(5'-phosphoribosyl)-ATP (PR-ATP). Has a crucial role in the pathway because the rate [...]
hisZ protein networkhttps://string-db.org/network/866895.HBHAL_4026ATP phosphoribosyltransferase regulatory subunit; Required for the first step of histidine biosynthesis. May allow the feedback regulation of ATP phosphoribosyltransferase activity by histidine.
CCG46368.1 protein networkhttps://string-db.org/network/866895.HBHAL_4027Putative acyl-CoA dehydrogenase.
CCG46369.1 protein networkhttps://string-db.org/network/866895.HBHAL_4028AMP-dependent synthetase and ligase.
CCG46370.1 protein networkhttps://string-db.org/network/866895.HBHAL_4029GlnR/MerR family transcription regulator.
CCG46371.1 protein networkhttps://string-db.org/network/866895.HBHAL_4030Hypothetical protein.
CCG46372.1 protein networkhttps://string-db.org/network/866895.HBHAL_4031Glycerol-3-phosphate dehydrogenase; Belongs to the FAD-dependent glycerol-3-phosphate dehydrogenase family.
glpK protein networkhttps://string-db.org/network/866895.HBHAL_4032Glycerol kinase; Key enzyme in the regulation of glycerol uptake and metabolism. Catalyzes the phosphorylation of glycerol to yield sn- glycerol 3-phosphate; Belongs to the FGGY kinase family.
CCG46374.1 protein networkhttps://string-db.org/network/866895.HBHAL_4033Glycerol uptake facilitator; Belongs to the MIP/aquaporin (TC 1.A.8) family.
CCG46375.1 protein networkhttps://string-db.org/network/866895.HBHAL_4034Glycerol uptake operon antiterminator regulatory protein; Regulates expression of the glpD operon. In the presence of glycerol 3-phosphate (G3P) causes antitermination of transcription of glpD at [...]
yvoF protein networkhttps://string-db.org/network/866895.HBHAL_4035Probable acetyltransferase.
ppaX protein networkhttps://string-db.org/network/866895.HBHAL_4036Pyrophosphatase PpaX.
yvoD protein networkhttps://string-db.org/network/866895.HBHAL_4037Hypothetical protein.
lgt protein networkhttps://string-db.org/network/866895.HBHAL_4038Prolipoprotein diacylglyceryl transferase; Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein, the [...]
hprK protein networkhttps://string-db.org/network/866895.HBHAL_4039HPr kinase/phosphorylase; Catalyzes the ATP- as well as the pyrophosphate-dependent phosphorylation of a specific serine residue in HPr, a phosphocarrier protein of the phosphoenolpyruvate-depend [...]
CCG46381.1 protein networkhttps://string-db.org/network/866895.HBHAL_4040Hypothetical protein.
yvlD protein networkhttps://string-db.org/network/866895.HBHAL_4041Conserved hypothetical protein.
yvlB protein networkhttps://string-db.org/network/866895.HBHAL_4042Hypothetical protein.
CCG46384.1 protein networkhttps://string-db.org/network/866895.HBHAL_4043Hypothetical protein.
CCG46385.1 protein networkhttps://string-db.org/network/866895.HBHAL_4044Hypothetical protein.
uvrA protein networkhttps://string-db.org/network/866895.HBHAL_4045Excinuclease ABC subunit A; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrA is an ATPase and a DNA-binding protein. A damage recognition complex composed of [...]
uvrB protein networkhttps://string-db.org/network/866895.HBHAL_4046Excinuclease ABC subunit B; The UvrABC repair system catalyzes the recognition and processing of DNA lesions. A damage recognition complex composed of 2 UvrA and 2 UvrB subunits scans DNA for abn [...]
CCG46388.1 protein networkhttps://string-db.org/network/866895.HBHAL_4047Two-component sensor histidine kinase / two-component response regulator.
CCG46389.1 protein networkhttps://string-db.org/network/866895.HBHAL_4048Two-component response regulator.
CCG46390.1 protein networkhttps://string-db.org/network/866895.HBHAL_4049Diguanylate cyclase domain protein / two-component response regulator.
prfC protein networkhttps://string-db.org/network/866895.HBHAL_4050Peptide chain release factor RF3; Increases the formation of ribosomal termination complexes and stimulates activities of RF-1 and RF-2. It binds guanine nucleotides and has strong preference for [...]
CCG46392.1 protein networkhttps://string-db.org/network/866895.HBHAL_4051Non-specific serine/threonine protein kinase.
CCG46393.1 protein networkhttps://string-db.org/network/866895.HBHAL_4052Conserved hypothetical protein.
ctaA protein networkhttps://string-db.org/network/866895.HBHAL_4053Heme A synthase.
CCG46395.1 protein networkhttps://string-db.org/network/866895.HBHAL_4054Hypothetical protein.
capD2 protein networkhttps://string-db.org/network/866895.HBHAL_4055Capsule depolymerase CapD.
capA2 protein networkhttps://string-db.org/network/866895.HBHAL_4056PGA biosynthesis protein CapA.
capC2 protein networkhttps://string-db.org/network/866895.HBHAL_4057PGA biosynthesis protein CapC.
capB2 protein networkhttps://string-db.org/network/866895.HBHAL_4058PGA synthase CapB.
CCG46400.1 protein networkhttps://string-db.org/network/866895.HBHAL_4059Hypothetical protein.
CCG46401.1 protein networkhttps://string-db.org/network/866895.HBHAL_4060Hypothetical protein.
CCG46402.1 protein networkhttps://string-db.org/network/866895.HBHAL_4061ABC-type transport system ATP-binding protein (probable substrate iron-III-dicitrate).
swrB protein networkhttps://string-db.org/network/866895.HBHAL_4062Hypothetical protein.
yvjB protein networkhttps://string-db.org/network/866895.HBHAL_4063Carboxyl-terminal protease; Belongs to the peptidase S41A family.
phnX protein networkhttps://string-db.org/network/866895.HBHAL_4064Phosphonoacetaldehyde phosphonohydrolase; Involved in phosphonate degradation; Belongs to the HAD-like hydrolase superfamily. PhnX family.
phnW protein networkhttps://string-db.org/network/866895.HBHAL_40652-aminoethylphosphonate:pyruvate aminotransferase; Involved in phosphonate degradation; Belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family. PhnW subfamily.
ftsE protein networkhttps://string-db.org/network/866895.HBHAL_4066ABC-type transport system ATP-binding protein; Part of the ABC transporter FtsEX involved in cellular division.
cccB protein networkhttps://string-db.org/network/866895.HBHAL_4067Cytochrome c-551.
yvjA protein networkhttps://string-db.org/network/866895.HBHAL_4068Conserved hypothetical protein.
gtaB1 protein networkhttps://string-db.org/network/866895.HBHAL_4069UTP-glucose-1-phosphate uridylyltransferase.
CCG46411.1 protein networkhttps://string-db.org/network/866895.HBHAL_4070Hypothetical protein.
prfB protein networkhttps://string-db.org/network/866895.HBHAL_4071Peptide chain release factor RF2; Peptide chain release factor 2 directs the termination of translation in response to the peptide chain termination codons UGA and UAA.
secA1 protein networkhttps://string-db.org/network/866895.HBHAL_4072Preprotein translocase subunit SecA; Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to [...]
CCG46414.1 protein networkhttps://string-db.org/network/866895.HBHAL_4073Hypothetical protein.
yvyD protein networkhttps://string-db.org/network/866895.HBHAL_4074Putative ribosomal subunit interface protein; Required for dimerization of active 70S ribosomes into 100S ribosomes in stationary phase; 100S ribosomes are translationally inactive and sometimes [...]
CCG46416.1 protein networkhttps://string-db.org/network/866895.HBHAL_4075Hypothetical protein.
fliT protein networkhttps://string-db.org/network/866895.HBHAL_4076Flagellar protein.
fliS protein networkhttps://string-db.org/network/866895.HBHAL_4077Flagellar protein.
fliD protein networkhttps://string-db.org/network/866895.HBHAL_4078Flagellar capping protein; Required for morphogenesis and for the elongation of the flagellar filament by facilitating polymerization of the flagellin monomers at the tip of growing filament. For [...]
CCG46420.1 protein networkhttps://string-db.org/network/866895.HBHAL_4079Hypothetical protein.
csrA protein networkhttps://string-db.org/network/866895.HBHAL_4080Carbon storage regulator homolog; A translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Usually binds in the 5'- UTR at or near the Shine-Dalgarno se [...]
fliW protein networkhttps://string-db.org/network/866895.HBHAL_4081Flagellar assembly protein; Acts as an anti-CsrA protein, binds CsrA and prevents it from repressing translation of its target genes, one of which is flagellin. Binds to flagellin and participate [...]
CCG46423.1 protein networkhttps://string-db.org/network/866895.HBHAL_4082Conserved hypothetical protein.
flgL protein networkhttps://string-db.org/network/866895.HBHAL_4083Flagellar hook-associated protein.
flgK protein networkhttps://string-db.org/network/866895.HBHAL_4084Flagellar hook-associated protein.
CCG46426.1 protein networkhttps://string-db.org/network/866895.HBHAL_4085Conserved hypothetical protein.
flgM protein networkhttps://string-db.org/network/866895.HBHAL_4086Anti-sigma factor repressor of sigma-D-dependent transcription.
yvyF protein networkhttps://string-db.org/network/866895.HBHAL_4086_AFlagellar protein YvyF.
comFC protein networkhttps://string-db.org/network/866895.HBHAL_4087Competence protein ComFC.
comF protein networkhttps://string-db.org/network/866895.HBHAL_4088ComF operon protein 1.
degV3 protein networkhttps://string-db.org/network/866895.HBHAL_4089DegV family protein.
CCG46432.1 protein networkhttps://string-db.org/network/866895.HBHAL_4090Two-component response regulator.
CCG46433.1 protein networkhttps://string-db.org/network/866895.HBHAL_4091Two-component sensor histidine kinase; Member of the two-component regulatory system DegS/DegU, which plays an important role in the transition growth phase.
yvyE protein networkhttps://string-db.org/network/866895.HBHAL_4092Hypothetical protein.
CCG46435.1 protein networkhttps://string-db.org/network/866895.HBHAL_4093LytR family transcription regulator.
tagO1 protein networkhttps://string-db.org/network/866895.HBHAL_4094Probable undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase.
CCG46437.1 protein networkhttps://string-db.org/network/866895.HBHAL_4095Cationic amino acid transporter.
CCG46438.1 protein networkhttps://string-db.org/network/866895.HBHAL_4096Conserved hypothetical protein.
CCG46439.1 protein networkhttps://string-db.org/network/866895.HBHAL_4097LytR family transcription regulator.
CCG46440.1 protein networkhttps://string-db.org/network/866895.HBHAL_4098Hypothetical protein.
CCG46441.1 protein networkhttps://string-db.org/network/866895.HBHAL_4099Hypothetical protein.
CCG46442.1 protein networkhttps://string-db.org/network/866895.HBHAL_4100Hypothetical protein.
amyA protein networkhttps://string-db.org/network/866895.HBHAL_4101Alpha-amylase catalytic region.
CCG46444.1 protein networkhttps://string-db.org/network/866895.HBHAL_4102Putative lipoprotein (haemin storage system) (HmsF).
galE2 protein networkhttps://string-db.org/network/866895.HBHAL_4103UDP-glucose 4-epimerase; Belongs to the NAD(P)-dependent epimerase/dehydratase family.
CCG46446.1 protein networkhttps://string-db.org/network/866895.HBHAL_4104Hypothetical protein.
CCG46447.1 protein networkhttps://string-db.org/network/866895.HBHAL_4105Conserved hypothetical protein.
CCG46448.1 protein networkhttps://string-db.org/network/866895.HBHAL_4106Conserved hypothetical protein.
CCG46449.1 protein networkhttps://string-db.org/network/866895.HBHAL_4107Conserved hypothetical protein.
CCG46450.1 protein networkhttps://string-db.org/network/866895.HBHAL_4108Group 1 glycosyltransferase.
pelG protein networkhttps://string-db.org/network/866895.HBHAL_4109Hypothetical protein.
CCG46452.1 protein networkhttps://string-db.org/network/866895.HBHAL_4110Hypothetical protein.
CCG46453.1 protein networkhttps://string-db.org/network/866895.HBHAL_4111Hypothetical protein.
CCG46454.1 protein networkhttps://string-db.org/network/866895.HBHAL_4112LacI family transcription regulator.
CCG46455.1 protein networkhttps://string-db.org/network/866895.HBHAL_4113ABC-type transport system permease protein (probables substrate maltose/maltodextrin).
CCG46456.1 protein networkhttps://string-db.org/network/866895.HBHAL_4114ABC-type transport system permease protein (probable substrate maltose/maltodextrin).
CCG46457.1 protein networkhttps://string-db.org/network/866895.HBHAL_4115ABC-type transport system extracellular binding protein (probable substrate maltose/maltodextrin).
nplT protein networkhttps://string-db.org/network/866895.HBHAL_4116Alpha-amylase.
fdaB protein networkhttps://string-db.org/network/866895.HBHAL_4117Fructose-1,6-bisphosphate aldolase; Belongs to the class I fructose-bisphosphate aldolase family.
CCG46460.1 protein networkhttps://string-db.org/network/866895.HBHAL_4118Conserved hypothetical protein.
p5cdh2 protein networkhttps://string-db.org/network/866895.HBHAL_41191-pyrroline-5-carboxylate dehydrogenase; Belongs to the aldehyde dehydrogenase family.
prodh2 protein networkhttps://string-db.org/network/866895.HBHAL_4120Proline dehydrogenase.
CCG46463.1 protein networkhttps://string-db.org/network/866895.HBHAL_4121Hypothetical protein.
CCG46464.1 protein networkhttps://string-db.org/network/866895.HBHAL_4122Anion-transporting ATPase family protein (probable substrate arsenate).
CCG46465.1 protein networkhttps://string-db.org/network/866895.HBHAL_4123Conserved hypothetical protein.
CCG46466.1 protein networkhttps://string-db.org/network/866895.HBHAL_4124Hypothetical protein.
cstA3 protein networkhttps://string-db.org/network/866895.HBHAL_4125Carbon starvation protein CstA.
gvpU protein networkhttps://string-db.org/network/866895.HBHAL_4126Gas vesicle protein GvpU.
CCG46469.1 protein networkhttps://string-db.org/network/866895.HBHAL_4127Hypothetical protein.
gvpJ protein networkhttps://string-db.org/network/866895.HBHAL_4128Gas vesicle protein GvpJ; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism a [...]
gvpK protein networkhttps://string-db.org/network/866895.HBHAL_4129Gas vesicle protein GvpK.
gvpS protein networkhttps://string-db.org/network/866895.HBHAL_4130Gas vesicle protein GvpS; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism a [...]
gvpL protein networkhttps://string-db.org/network/866895.HBHAL_4131Gas vesicle protein GvpL.
gvpG protein networkhttps://string-db.org/network/866895.HBHAL_4132Gas vesicle protein GvpG.
gvpF protein networkhttps://string-db.org/network/866895.HBHAL_4133Gas vesicle protein GvpF.
gvpN protein networkhttps://string-db.org/network/866895.HBHAL_4134Gas vesicle protein GvpN.
gvpR protein networkhttps://string-db.org/network/866895.HBHAL_4135Gas vesicle protein GvpR.
gvpA protein networkhttps://string-db.org/network/866895.HBHAL_4136Gas vesicle protein GvpA; Gas vesicles are small, hollow, gas filled protein structures that are found in several microbial planktonic microorganisms. They allow the positioning of the organism a [...]
gvpQ protein networkhttps://string-db.org/network/866895.HBHAL_4137Gas vesicle protein GvpQ.
CCG46480.1 protein networkhttps://string-db.org/network/866895.HBHAL_4138Fumarylacetoacetase.
yfiQ protein networkhttps://string-db.org/network/866895.HBHAL_4139Intercellular adhesion protein C.
CCG46482.1 protein networkhttps://string-db.org/network/866895.HBHAL_4140Hypothetical protein.
pcp protein networkhttps://string-db.org/network/866895.HBHAL_4141Pyrrolidone-carboxylate peptidase; Removes 5-oxoproline from various penultimate amino acid residues except L-proline; Belongs to the peptidase C15 family.
CCG46484.1 protein networkhttps://string-db.org/network/866895.HBHAL_4142Hypothetical protein.
CCG46485.1 protein networkhttps://string-db.org/network/866895.HBHAL_4143Conserved hypothetical protein.
CCG46486.1 protein networkhttps://string-db.org/network/866895.HBHAL_4144Conserved hypothetical protein.
ybbH protein networkhttps://string-db.org/network/866895.HBHAL_4145RpiR family transcription regulator.
CCG46488.1 protein networkhttps://string-db.org/network/866895.HBHAL_4146ABC-type transport system permease protein (probable substrate N-acetylglucosamine).
CCG46489.1 protein networkhttps://string-db.org/network/866895.HBHAL_4147ABC-type transport system permease protein (probable substrate N-acetylglucosamine).
CCG46490.1 protein networkhttps://string-db.org/network/866895.HBHAL_4148ABC-type transport system extracellular binding protein (probable substrate N-acetylglucosamine).
ybbI protein networkhttps://string-db.org/network/866895.HBHAL_4149N-acetylmuramic acid-6-phosphate etherase; Specifically catalyzes the cleavage of the D-lactyl ether substituent of MurNAc 6-phosphate, producing GlcNAc 6-phosphate and D- lactate.
CCG46492.1 protein networkhttps://string-db.org/network/866895.HBHAL_4150ATPase, BadF/BadG/BcrA/BcrD type.
CCG46493.1 protein networkhttps://string-db.org/network/866895.HBHAL_4151Hypothetical protein; Belongs to the UPF0312 family.
CCG46494.1 protein networkhttps://string-db.org/network/866895.HBHAL_4152Hypothetical protein.
CCG46495.1 protein networkhttps://string-db.org/network/866895.HBHAL_4153Pyrrolo-quinoline quinone.
CCG46496.1 protein networkhttps://string-db.org/network/866895.HBHAL_4154MFS-type transporter (probable function oxalate/formate antiporter).
CCG46497.1 protein networkhttps://string-db.org/network/866895.HBHAL_4155Hypothetical protein.
CCG46498.1 protein networkhttps://string-db.org/network/866895.HBHAL_4156Hypothetical protein.
CCG46499.1 protein networkhttps://string-db.org/network/866895.HBHAL_4157Spore germination protein.
CCG46500.1 protein networkhttps://string-db.org/network/866895.HBHAL_4158Hypothetical protein.
CCG46501.1 protein networkhttps://string-db.org/network/866895.HBHAL_4159Conserved hypothetical protein.
CCG46502.1 protein networkhttps://string-db.org/network/866895.HBHAL_4160Hypothetical protein.
CCG46503.1 protein networkhttps://string-db.org/network/866895.HBHAL_4161Hypothetical protein.
CCG46504.1 protein networkhttps://string-db.org/network/866895.HBHAL_4162Conserved hypothetical protein.
CCG46505.1 protein networkhttps://string-db.org/network/866895.HBHAL_4163Homolog to 1,4-dihydroxy-2-naphthoate polyprenyltransferase.
CCG46506.1 protein networkhttps://string-db.org/network/866895.HBHAL_4164IS200-type transposase.
CCG46507.1 protein networkhttps://string-db.org/network/866895.HBHAL_4165IS1341-type transposase.
CCG46508.1 protein networkhttps://string-db.org/network/866895.HBHAL_4166Hypothetical protein.
CCG46509.1 protein networkhttps://string-db.org/network/866895.HBHAL_4167HAD superfamily hydrolase.
CCG46510.1 protein networkhttps://string-db.org/network/866895.HBHAL_4168Hypothetical protein.
CCG46511.1 protein networkhttps://string-db.org/network/866895.HBHAL_4169Hypothetical protein.
ycsI protein networkhttps://string-db.org/network/866895.HBHAL_4170Hypothetical protein; Belongs to the D-glutamate cyclase family.
malL2 protein networkhttps://string-db.org/network/866895.HBHAL_4171Oligo-1,6-glucosidase.
CCG46514.1 protein networkhttps://string-db.org/network/866895.HBHAL_4172Hypothetical protein.
CCG46515.1 protein networkhttps://string-db.org/network/866895.HBHAL_4173Conserved hypothetical protein.
CCG46516.1 protein networkhttps://string-db.org/network/866895.HBHAL_4174Acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase.
atoA protein networkhttps://string-db.org/network/866895.HBHAL_4175CoA-transferase subunit B.
atoD protein networkhttps://string-db.org/network/866895.HBHAL_4176CoA-transferase subunit A.
CCG46519.1 protein networkhttps://string-db.org/network/866895.HBHAL_4177Aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family.
CCG46520.1 protein networkhttps://string-db.org/network/866895.HBHAL_4178PucR family transcription regulator.
CCG46521.1 protein networkhttps://string-db.org/network/866895.HBHAL_4179Homolog to TcdC protein.
gtaB2 protein networkhttps://string-db.org/network/866895.HBHAL_4180UTP-glucose-1-phosphate uridylyltransferase.
purU protein networkhttps://string-db.org/network/866895.HBHAL_4181Formyltetrahydrofolate deformylase; Catalyzes the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to formate and tetrahydrofolate (FH4).
CCG46524.1 protein networkhttps://string-db.org/network/866895.HBHAL_4182Acetyltransferase, GNAT family.
CCG46525.1 protein networkhttps://string-db.org/network/866895.HBHAL_4183IS231-type transposase.
CCG46526.1 protein networkhttps://string-db.org/network/866895.HBHAL_4184Hypothetical protein.
CCG46527.1 protein networkhttps://string-db.org/network/866895.HBHAL_4185gamma-DL-glutamyl hydrolase.
CCG46528.1 protein networkhttps://string-db.org/network/866895.HBHAL_41863-oxoacyl-[acyl carrier protein] reductase.
CCG46529.1 protein networkhttps://string-db.org/network/866895.HBHAL_4187Fumarylacetoacetase.
CCG46530.1 protein networkhttps://string-db.org/network/866895.HBHAL_4188TRAP-T type transporter.
CCG46531.1 protein networkhttps://string-db.org/network/866895.HBHAL_4189Hypothetical protein.
CCG46532.1 protein networkhttps://string-db.org/network/866895.HBHAL_4190Putative TRAP-T type transporter solute receptor.
CCG46533.1 protein networkhttps://string-db.org/network/866895.HBHAL_4191Two-component response regulator.
CCG46534.1 protein networkhttps://string-db.org/network/866895.HBHAL_4192Two-component sensor histidine kinase.
dctP3 protein networkhttps://string-db.org/network/866895.HBHAL_4193Probable TRAP-T type transporter subunit DctP.
CCG46536.1 protein networkhttps://string-db.org/network/866895.HBHAL_4194Hypothetical protein.
CCG46538.1 protein networkhttps://string-db.org/network/866895.HBHAL_4196FAD-dependent oxidoreductase.
CCG46539.1 protein networkhttps://string-db.org/network/866895.HBHAL_4197Conserved hypothetical protein.
glxK protein networkhttps://string-db.org/network/866895.HBHAL_4198Glycerate kinase; Belongs to the glycerate kinase type-1 family.
npr2 protein networkhttps://string-db.org/network/866895.HBHAL_4199Neutral protease; Extracellular zinc metalloprotease.
CCG46542.1 protein networkhttps://string-db.org/network/866895.HBHAL_4200Hypothetical protein.
CCG46543.1 protein networkhttps://string-db.org/network/866895.HBHAL_4201Conserved hypothetical protein.
CCG46544.1 protein networkhttps://string-db.org/network/866895.HBHAL_4202Aminoacylase.
CCG46545.1 protein networkhttps://string-db.org/network/866895.HBHAL_4203Hypothetical protein.
CCG46546.1 protein networkhttps://string-db.org/network/866895.HBHAL_42042,5-didehydrogluconate reductase.
CCG46547.1 protein networkhttps://string-db.org/network/866895.HBHAL_4205AsnC family transcription regulator.
CCG46548.1 protein networkhttps://string-db.org/network/866895.HBHAL_4206Aminotransferase.
pgdS protein networkhttps://string-db.org/network/866895.HBHAL_4207gamma-DL-glutamyl hydrolase.
CCG46550.1 protein networkhttps://string-db.org/network/866895.HBHAL_4208Hypothetical protein; Belongs to the sigma-70 factor family.
CCG46551.1 protein networkhttps://string-db.org/network/866895.HBHAL_4209Glycoside hydrolase, family 16.
CCG46552.1 protein networkhttps://string-db.org/network/866895.HBHAL_4210LacI family transcription regulator.
CCG46553.1 protein networkhttps://string-db.org/network/866895.HBHAL_4211Hypothetical protein.
bglA protein networkhttps://string-db.org/network/866895.HBHAL_4213Beta-glucosidase.
CCG46556.1 protein networkhttps://string-db.org/network/866895.HBHAL_4214ABC-type transport system permease protein (probable substrate sugar/cellobiose).
CCG46557.1 protein networkhttps://string-db.org/network/866895.HBHAL_4215ABC-type transport system permease protein (probable substrate sugar/cellobiose).
CCG46558.1 protein networkhttps://string-db.org/network/866895.HBHAL_4216ABC-type transport system extracellular binding protein (probable substrate sugar/cellobiose).
CCG46559.1 protein networkhttps://string-db.org/network/866895.HBHAL_4217LytR family transcription regulator.
CCG46560.1 protein networkhttps://string-db.org/network/866895.HBHAL_4218Conserved hypothetical protein.
CCG46561.1 protein networkhttps://string-db.org/network/866895.HBHAL_4219NADH:flavin oxidoreductase / NADH oxidase family protein.
CCG46562.1 protein networkhttps://string-db.org/network/866895.HBHAL_4220Conserved hypothetical protein.
CCG46563.1 protein networkhttps://string-db.org/network/866895.HBHAL_4221Hypothetical protein.
arsC protein networkhttps://string-db.org/network/866895.HBHAL_4222Arsenate reductase; Catalyzes the reduction of arsenate [As(V)] to arsenite [As(III)].
ydfA protein networkhttps://string-db.org/network/866895.HBHAL_4223Probable arsenical pump membrane protein YdfA; Involved in arsenical resistance. Thought to form the channel of an arsenite pump; Belongs to the ArsB family.
CCG46566.1 protein networkhttps://string-db.org/network/866895.HBHAL_4224ArsR family transcription regulator.
CCG46567.1 protein networkhttps://string-db.org/network/866895.HBHAL_4225Hypothetical protein.
CCG46568.1 protein networkhttps://string-db.org/network/866895.HBHAL_4226Hypothetical protein.
tgl protein networkhttps://string-db.org/network/866895.HBHAL_4227Transglutaminase.
CCG46570.1 protein networkhttps://string-db.org/network/866895.HBHAL_4228Hypothetical protein.
capE protein networkhttps://string-db.org/network/866895.HBHAL_4229PGA biosynthesis protein CapE.
capD1 protein networkhttps://string-db.org/network/866895.HBHAL_4230Capsule depolymerase CapD.
capA1 protein networkhttps://string-db.org/network/866895.HBHAL_4231PGA biosynthesis protein CapA.
capC1 protein networkhttps://string-db.org/network/866895.HBHAL_4232PGA biosynthesis protein CapC.
capB1 protein networkhttps://string-db.org/network/866895.HBHAL_4233PGA synthase CapB.
CCG46576.1 protein networkhttps://string-db.org/network/866895.HBHAL_4234Hypothetical protein.
CCG46577.1 protein networkhttps://string-db.org/network/866895.HBHAL_4235Hypothetical protein.
CCG46578.1 protein networkhttps://string-db.org/network/866895.HBHAL_4236CRP/FNR family transcription regulator.
CCG46579.1 protein networkhttps://string-db.org/network/866895.HBHAL_4237Hypothetical protein.
CCG46581.1 protein networkhttps://string-db.org/network/866895.HBHAL_4239ZIP family transporter (probable substrate divalent heavy-metal cations).
CCG46582.1 protein networkhttps://string-db.org/network/866895.HBHAL_4240Conserved hypothetical protein.
CCG46583.1 protein networkhttps://string-db.org/network/866895.HBHAL_4241Conserved hypothetical protein.
CCG46584.1 protein networkhttps://string-db.org/network/866895.HBHAL_4242Hypothetical protein.
CCG46585.1 protein networkhttps://string-db.org/network/866895.HBHAL_4243Hypothetical protein.
CCG46586.1 protein networkhttps://string-db.org/network/866895.HBHAL_4244Putative short-chain fatty acid transporter.
CCG46587.1 protein networkhttps://string-db.org/network/866895.HBHAL_4245Sporulation control protein.
CCG46588.1 protein networkhttps://string-db.org/network/866895.HBHAL_4246Hypothetical protein.
CCG46589.1 protein networkhttps://string-db.org/network/866895.HBHAL_4247GlnR/MerR family transcription regulator.
CCG46590.1 protein networkhttps://string-db.org/network/866895.HBHAL_4248Conserved hypothetical protein.
CCG46591.1 protein networkhttps://string-db.org/network/866895.HBHAL_4249Hypothetical protein.
CCG46592.1 protein networkhttps://string-db.org/network/866895.HBHAL_4250Hypothetical protein.
CCG46593.1 protein networkhttps://string-db.org/network/866895.HBHAL_4251Hypothetical protein.
CCG46594.1 protein networkhttps://string-db.org/network/866895.HBHAL_4252TetR family transcription regulator.
swrC protein networkhttps://string-db.org/network/866895.HBHAL_4253Swarming motility protein SwrC; Belongs to the resistance-nodulation-cell division (RND) (TC 2.A.6) family.
CCG46596.1 protein networkhttps://string-db.org/network/866895.HBHAL_4254Hypothetical protein.
CCG46597.1 protein networkhttps://string-db.org/network/866895.HBHAL_4255Conserved hypothetical protein.
CCG46598.1 protein networkhttps://string-db.org/network/866895.HBHAL_4256MFS-type transporter (probable sugar permease).
CCG46599.1 protein networkhttps://string-db.org/network/866895.HBHAL_4257Hypothetical protein.
CCG46600.1 protein networkhttps://string-db.org/network/866895.HBHAL_4258Hypothetical protein.
CCG46601.1 protein networkhttps://string-db.org/network/866895.HBHAL_4259Conserved hypothetical protein.
ldh2 protein networkhttps://string-db.org/network/866895.HBHAL_4261L-lactate dehydrogenase; Catalyzes the conversion of lactate to pyruvate. Belongs to the LDH/MDH superfamily. LDH family.
CCG46604.1 protein networkhttps://string-db.org/network/866895.HBHAL_4262L-lactate permease family transporter; Transports L-lactate across the membrane. Can also transport D-lactate and glycolate; Belongs to the lactate permease family.
CCG46605.1 protein networkhttps://string-db.org/network/866895.HBHAL_4263Hypothetical protein.
CCG46606.1 protein networkhttps://string-db.org/network/866895.HBHAL_4264Conserved hypothetical protein.
CCG46607.1 protein networkhttps://string-db.org/network/866895.HBHAL_4265Hypothetical protein.
CCG46608.1 protein networkhttps://string-db.org/network/866895.HBHAL_4266Hypothetical protein.
CCG46609.1 protein networkhttps://string-db.org/network/866895.HBHAL_4267Hypothetical protein.
CCG46610.1 protein networkhttps://string-db.org/network/866895.HBHAL_4268Hypothetical protein.
CCG46611.1 protein networkhttps://string-db.org/network/866895.HBHAL_4269Hypothetical protein.
CCG46613.1 protein networkhttps://string-db.org/network/866895.HBHAL_4271Conserved hypothetical protein.
CCG46614.1 protein networkhttps://string-db.org/network/866895.HBHAL_4273Hypothetical protein.
CCG46615.1 protein networkhttps://string-db.org/network/866895.HBHAL_4274Hypothetical protein.
CCG46616.1 protein networkhttps://string-db.org/network/866895.HBHAL_4275Monooxygenase, FAD-binding.
CCG46617.1 protein networkhttps://string-db.org/network/866895.HBHAL_4276AraC family transcription regulator.
CCG46618.1 protein networkhttps://string-db.org/network/866895.HBHAL_4277Hypothetical protein.
lcdH protein networkhttps://string-db.org/network/866895.HBHAL_42783-hydroxyacyl-CoA dehydrogenase; Catalyzes the NAD(+)-dependent oxidation of L-carnitine to 3- dehydrocarnitine.
CCG46620.1 protein networkhttps://string-db.org/network/866895.HBHAL_4279Hypothetical protein.
CCG46621.1 protein networkhttps://string-db.org/network/866895.HBHAL_4280TetR family transcription regulator.
CCG46622.1 protein networkhttps://string-db.org/network/866895.HBHAL_4281Putative polysaccharide deacetylase.
CCG46623.1 protein networkhttps://string-db.org/network/866895.HBHAL_4282Hypothetical protein.
CCG46624.1 protein networkhttps://string-db.org/network/866895.HBHAL_4283Hypothetical protein.
CCG46625.1 protein networkhttps://string-db.org/network/866895.HBHAL_4284Acetyltransferase, GNAT family.
CCG46626.1 protein networkhttps://string-db.org/network/866895.HBHAL_4285Hypothetical protein.
CCG46627.1 protein networkhttps://string-db.org/network/866895.HBHAL_4286Esterase.
CCG46628.1 protein networkhttps://string-db.org/network/866895.HBHAL_4287Hypothetical protein.
CCG46629.1 protein networkhttps://string-db.org/network/866895.HBHAL_4288Hypothetical protein.
CCG46630.1 protein networkhttps://string-db.org/network/866895.HBHAL_4289Hypothetical protein.
CCG46631.1 protein networkhttps://string-db.org/network/866895.HBHAL_4290Hypothetical protein.
CCG46632.1 protein networkhttps://string-db.org/network/866895.HBHAL_4291Hypothetical protein.
yflH protein networkhttps://string-db.org/network/866895.HBHAL_4292Hypothetical protein.
CCG46634.1 protein networkhttps://string-db.org/network/866895.HBHAL_4293Putative transporter.
CCG46635.1 protein networkhttps://string-db.org/network/866895.HBHAL_4294Hypothetical protein.
CCG46636.1 protein networkhttps://string-db.org/network/866895.HBHAL_4295Hypothetical protein.
CCG46637.1 protein networkhttps://string-db.org/network/866895.HBHAL_4296Hypothetical protein.
ywqN protein networkhttps://string-db.org/network/866895.HBHAL_4297Probable trp repressor-binding protein.
CCG46639.1 protein networkhttps://string-db.org/network/866895.HBHAL_4298Hypothetical protein.
CCG46640.1 protein networkhttps://string-db.org/network/866895.HBHAL_4299Hypothetical protein.
CCG46641.1 protein networkhttps://string-db.org/network/866895.HBHAL_4300Hypothetical protein.
CCG46643.1 protein networkhttps://string-db.org/network/866895.HBHAL_4302Hypothetical protein.
CCG46644.1 protein networkhttps://string-db.org/network/866895.HBHAL_4303PadR family transcription regulator.
CCG46645.1 protein networkhttps://string-db.org/network/866895.HBHAL_4304Hypothetical protein.
CCG46647.1 protein networkhttps://string-db.org/network/866895.HBHAL_4306Acetyltransferase, GNAT family.
CCG46648.1 protein networkhttps://string-db.org/network/866895.HBHAL_4307Penicillin-binding protein.
CCG46649.1 protein networkhttps://string-db.org/network/866895.HBHAL_4308Hypothetical protein.
gldA protein networkhttps://string-db.org/network/866895.HBHAL_4309Glycerol dehydrogenase.
CCG46651.1 protein networkhttps://string-db.org/network/866895.HBHAL_4310Hypothetical protein.
CCG46652.1 protein networkhttps://string-db.org/network/866895.HBHAL_4311Hypothetical protein.
CCG46653.1 protein networkhttps://string-db.org/network/866895.HBHAL_4312AraC effector binding domain protein.
CCG46654.1 protein networkhttps://string-db.org/network/866895.HBHAL_4313Trifolitoxin immunity domain protein.
CCG46655.1 protein networkhttps://string-db.org/network/866895.HBHAL_4314Hypothetical protein.
CCG46656.1 protein networkhttps://string-db.org/network/866895.HBHAL_4315ArsR family transcription regulator.
yveD protein networkhttps://string-db.org/network/866895.HBHAL_4316Hypothetical protein.
CCG46658.1 protein networkhttps://string-db.org/network/866895.HBHAL_4317PadR family transcription regulator.
ureD protein networkhttps://string-db.org/network/866895.HBHAL_4318Urease accessory protein UreD; Required for maturation of urease via the functional incorporation of the urease nickel metallocenter.
ureG protein networkhttps://string-db.org/network/866895.HBHAL_4319Urease accessory protein UreG; Facilitates the functional incorporation of the urease nickel metallocenter. This process requires GTP hydrolysis, probably effectuated by UreG.
ureF protein networkhttps://string-db.org/network/866895.HBHAL_4321Urease accessory protein UreF; Required for maturation of urease via the functional incorporation of the urease nickel metallocenter.
ureE protein networkhttps://string-db.org/network/866895.HBHAL_4322Urease accessory protein UreE; Involved in urease metallocenter assembly. Binds nickel. Probably functions as a nickel donor during metallocenter assembly. Belongs to the UreE family.
ureC protein networkhttps://string-db.org/network/866895.HBHAL_4323Urease alpha subunit.
ureB protein networkhttps://string-db.org/network/866895.HBHAL_4324Urease beta subunit; Belongs to the urease beta subunit family.
ureA protein networkhttps://string-db.org/network/866895.HBHAL_4325Urease gamma subunit; Belongs to the urease gamma subunit family.
CCG46667.1 protein networkhttps://string-db.org/network/866895.HBHAL_4326Hypothetical protein.
CCG46668.1 protein networkhttps://string-db.org/network/866895.HBHAL_4327Putative transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
CCG46669.1 protein networkhttps://string-db.org/network/866895.HBHAL_4328ABC-type transport system permease protein (probable substrate iron complex); Belongs to the binding-protein-dependent transport system permease family. FecCD subfamily.
CCG46670.1 protein networkhttps://string-db.org/network/866895.HBHAL_4329ABC-type transport system ATP-binding protein (probable substrate iron complex).
CCG46671.1 protein networkhttps://string-db.org/network/866895.HBHAL_4330ABC-type transport system extracellular binding protein (probable substrate iron complex).
ydaF protein networkhttps://string-db.org/network/866895.HBHAL_4331Conserved hypothetical protein.
CCG46673.1 protein networkhttps://string-db.org/network/866895.HBHAL_4332DNA polymerase beta domain protein region.
CCG46674.1 protein networkhttps://string-db.org/network/866895.HBHAL_4333Ferroxidase; Iron-storage protein.
CCG46675.1 protein networkhttps://string-db.org/network/866895.HBHAL_4334Rubrerythrin family protein.
yxiS protein networkhttps://string-db.org/network/866895.HBHAL_4335Hypothetical protein.
ybaJ protein networkhttps://string-db.org/network/866895.HBHAL_4336Probable methyltransferase YbaJ.
CCG46678.1 protein networkhttps://string-db.org/network/866895.HBHAL_4337DUF21/CBS domain protein.
CCG46679.1 protein networkhttps://string-db.org/network/866895.HBHAL_4338DUF21/CBS domain protein.
CCG46680.1 protein networkhttps://string-db.org/network/866895.HBHAL_4339Putative sporulation control protein.
CCG46681.1 protein networkhttps://string-db.org/network/866895.HBHAL_4340Allantoate amidohydrolase.
CCG46682.1 protein networkhttps://string-db.org/network/866895.HBHAL_4341Hypothetical protein.
CCG46683.1 protein networkhttps://string-db.org/network/866895.HBHAL_4342Cell wall endopeptidase, family M23/M37.
CCG46684.1 protein networkhttps://string-db.org/network/866895.HBHAL_4343MtlR/BglG family transcription regulator.
CCG46685.1 protein networkhttps://string-db.org/network/866895.HBHAL_4344PTS system subunit IIB.
CCG46686.1 protein networkhttps://string-db.org/network/866895.HBHAL_4345PTS system subunit IIC.
CCG46687.1 protein networkhttps://string-db.org/network/866895.HBHAL_4346Hypothetical protein.
CCG46688.1 protein networkhttps://string-db.org/network/866895.HBHAL_4347Hypothetical protein.
CCG46689.1 protein networkhttps://string-db.org/network/866895.HBHAL_4348Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
catE protein networkhttps://string-db.org/network/866895.HBHAL_4350Catechol-2,3-dioxygenase.
CCG46692.1 protein networkhttps://string-db.org/network/866895.HBHAL_4351Hypothetical protein.
CCG46693.1 protein networkhttps://string-db.org/network/866895.HBHAL_4352Hypothetical protein.
CCG46694.1 protein networkhttps://string-db.org/network/866895.HBHAL_4353Conserved hypothetical protein.
CCG46695.1 protein networkhttps://string-db.org/network/866895.HBHAL_4354Short-chain dehydrogenase/reductase family protein.
CCG46696.1 protein networkhttps://string-db.org/network/866895.HBHAL_4355SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
CCG46697.1 protein networkhttps://string-db.org/network/866895.HBHAL_4356Hypothetical protein.
CCG46698.1 protein networkhttps://string-db.org/network/866895.HBHAL_4357Phosphoglycerate mutase family protein.
CCG46700.1 protein networkhttps://string-db.org/network/866895.HBHAL_4359Hypothetical protein.
CCG46701.1 protein networkhttps://string-db.org/network/866895.HBHAL_4360Hypothetical protein.
CCG46702.1 protein networkhttps://string-db.org/network/866895.HBHAL_4361Hypothetical protein.
CCG46704.1 protein networkhttps://string-db.org/network/866895.HBHAL_4363Hypothetical protein.
CCG46705.1 protein networkhttps://string-db.org/network/866895.HBHAL_4364Hypothetical protein.
CCG46706.1 protein networkhttps://string-db.org/network/866895.HBHAL_4365Hypothetical protein.
CCG46708.1 protein networkhttps://string-db.org/network/866895.HBHAL_4367Hypothetical protein.
CCG46709.1 protein networkhttps://string-db.org/network/866895.HBHAL_4368Hypothetical protein.
CCG46710.1 protein networkhttps://string-db.org/network/866895.HBHAL_4369Alpha/beta fold hydrolase.
CCG46711.1 protein networkhttps://string-db.org/network/866895.HBHAL_4370Hypothetical protein.
CCG46712.1 protein networkhttps://string-db.org/network/866895.HBHAL_4371Hypothetical protein.
CCG46713.1 protein networkhttps://string-db.org/network/866895.HBHAL_4372Hypothetical protein.
CCG46714.1 protein networkhttps://string-db.org/network/866895.HBHAL_4373Hypothetical protein.
CCG46715.1 protein networkhttps://string-db.org/network/866895.HBHAL_4374Hypothetical protein.
CCG46716.1 protein networkhttps://string-db.org/network/866895.HBHAL_4375TetR family transcription regulator.
CCG46717.1 protein networkhttps://string-db.org/network/866895.HBHAL_4377MFS-type transporter.
CCG46718.1 protein networkhttps://string-db.org/network/866895.HBHAL_4378Hypothetical protein.
CCG46719.1 protein networkhttps://string-db.org/network/866895.HBHAL_4379Alcohol dehydrogenase.
CCG46720.1 protein networkhttps://string-db.org/network/866895.HBHAL_4380Hypothetical protein.
CCG46721.1 protein networkhttps://string-db.org/network/866895.HBHAL_4381Hypothetical protein.
ytxJ2 protein networkhttps://string-db.org/network/866895.HBHAL_4384Conserved hypothetical protein.
CCG46725.1 protein networkhttps://string-db.org/network/866895.HBHAL_4385Hypothetical protein.
CCG46726.1 protein networkhttps://string-db.org/network/866895.HBHAL_4386Hypothetical protein.
CCG46727.1 protein networkhttps://string-db.org/network/866895.HBHAL_4387Hypothetical protein.
srfJ protein networkhttps://string-db.org/network/866895.HBHAL_4388Glucosylceramidase; Belongs to the glycosyl hydrolase 30 family.
CCG46729.1 protein networkhttps://string-db.org/network/866895.HBHAL_4389ABC-type transport system permease protein (probable substrate sugar/cellobiose).
CCG46730.1 protein networkhttps://string-db.org/network/866895.HBHAL_4390ABC-type transport system permease protein (probable substrate sugar/cellobiose).
CCG46731.1 protein networkhttps://string-db.org/network/866895.HBHAL_4391ABC-type transport system extracellular binding protein (probable substrate sugar/cellobiose).
yesL protein networkhttps://string-db.org/network/866895.HBHAL_4392Hypothetical protein.
CCG46733.1 protein networkhttps://string-db.org/network/866895.HBHAL_4393LacI family transcription regulator.
CCG46734.1 protein networkhttps://string-db.org/network/866895.HBHAL_4394DnaD domain protein.
CCG46735.1 protein networkhttps://string-db.org/network/866895.HBHAL_4395Hypothetical protein.
HBHAL_4397 protein networkhttps://string-db.org/network/866895.HBHAL_4397Short-chain dehydrogenase/reductase family protein (nonfunctional).
CCG46738.1 protein networkhttps://string-db.org/network/866895.HBHAL_4398Hypothetical protein.
CCG46740.1 protein networkhttps://string-db.org/network/866895.HBHAL_4400FAD-dependent oxidoreductase.
CCG46741.1 protein networkhttps://string-db.org/network/866895.HBHAL_4401IS1341-type transposase.
CCG46742.1 protein networkhttps://string-db.org/network/866895.HBHAL_4402Hypothetical protein.
dctM1 protein networkhttps://string-db.org/network/866895.HBHAL_4403TRAP-T type transporter subunit DctM.
dctQ1 protein networkhttps://string-db.org/network/866895.HBHAL_4404TRAP-T type transporter subunit DctQ.
dctP1 protein networkhttps://string-db.org/network/866895.HBHAL_4405TRAP-T type transporter subunit DctP.
CCG46746.1 protein networkhttps://string-db.org/network/866895.HBHAL_4406GntR family transcription regulator.
CCG46747.1 protein networkhttps://string-db.org/network/866895.HBHAL_4407Hypothetical protein.
yckC4 protein networkhttps://string-db.org/network/866895.HBHAL_4408RDD domain protein.
yckC5 protein networkhttps://string-db.org/network/866895.HBHAL_4409RDD domain protein.
CCG46750.1 protein networkhttps://string-db.org/network/866895.HBHAL_4410Hypothetical protein.
CCG46751.1 protein networkhttps://string-db.org/network/866895.HBHAL_4411Hypothetical protein.
CCG46752.1 protein networkhttps://string-db.org/network/866895.HBHAL_4412Hypothetical protein.
CCG46753.1 protein networkhttps://string-db.org/network/866895.HBHAL_4413Hypothetical protein.
CCG46754.1 protein networkhttps://string-db.org/network/866895.HBHAL_4414Conserved hypothetical protein.
CCG46755.1 protein networkhttps://string-db.org/network/866895.HBHAL_4415Hypothetical protein.
CCG46756.1 protein networkhttps://string-db.org/network/866895.HBHAL_4416Hypothetical protein.
CCG46757.1 protein networkhttps://string-db.org/network/866895.HBHAL_4417Acyltransferase 3.
CCG46758.1 protein networkhttps://string-db.org/network/866895.HBHAL_4418Acyltransferase family protein.
CCG46759.1 protein networkhttps://string-db.org/network/866895.HBHAL_4419Putative polysaccharide polymerase.
sat2 protein networkhttps://string-db.org/network/866895.HBHAL_4420Sulfate adenylyltransferase; Belongs to the sulfate adenylyltransferase family.
cysQ protein networkhttps://string-db.org/network/866895.HBHAL_44213'(2'),5'-bisphosphate nucleotidase; Converts adenosine-3',5'-bisphosphate (PAP) to AMP. Belongs to the inositol monophosphatase superfamily. CysQ family.
cysC2 protein networkhttps://string-db.org/network/866895.HBHAL_4422Adenylylsulfate kinase; Catalyzes the synthesis of activated sulfate.
sac1 protein networkhttps://string-db.org/network/866895.HBHAL_4423TrkA-C domain protein.
CCG46764.1 protein networkhttps://string-db.org/network/866895.HBHAL_4424Group 1 glycosyltransferase.
CCG46765.1 protein networkhttps://string-db.org/network/866895.HBHAL_4425Conserved hypothetical protein.
CCG46766.1 protein networkhttps://string-db.org/network/866895.HBHAL_4426UDP-N-acetyl-D-mannosamine dehydrogenase; Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
CCG46767.1 protein networkhttps://string-db.org/network/866895.HBHAL_4427Hypothetical protein.
CCG46768.1 protein networkhttps://string-db.org/network/866895.HBHAL_4428Sulfotransferase.
CCG46769.1 protein networkhttps://string-db.org/network/866895.HBHAL_4429Hypothetical protein.
CCG46770.1 protein networkhttps://string-db.org/network/866895.HBHAL_4430Group 1 glycosyltransferase.
CCG46771.1 protein networkhttps://string-db.org/network/866895.HBHAL_4431O-antigen translocase.
galE4 protein networkhttps://string-db.org/network/866895.HBHAL_4432UDP-glucose 4-epimerase.
tuaA protein networkhttps://string-db.org/network/866895.HBHAL_4433TuaA.
CCG46774.1 protein networkhttps://string-db.org/network/866895.HBHAL_4434Capsular polysaccharide biosynthesis protein,putative protein-tyrosine phosphatase.
CCG46775.1 protein networkhttps://string-db.org/network/866895.HBHAL_4435Capsular polysaccharide biosynthesis protein,putative tyrosine-protein kinase.
CCG46776.1 protein networkhttps://string-db.org/network/866895.HBHAL_4436Capsular polysaccharide biosynthesis protein,putative chain length regulator.
CCG46777.1 protein networkhttps://string-db.org/network/866895.HBHAL_4437Hypothetical protein.
CCG46778.1 protein networkhttps://string-db.org/network/866895.HBHAL_4438Conserved hypothetical protein.
CCG46779.1 protein networkhttps://string-db.org/network/866895.HBHAL_4439Hypothetical protein.
CCG46780.1 protein networkhttps://string-db.org/network/866895.HBHAL_4440Hypothetical protein.
prtB protein networkhttps://string-db.org/network/866895.HBHAL_4441S8/S53 family peptidase; Belongs to the peptidase S8 family.
secA2 protein networkhttps://string-db.org/network/866895.HBHAL_4442Preprotein translocase subunit SecA; Part of the Sec protein translocase complex. Interacts with the SecYEG preprotein conducting channel. Has a central role in coupling the hydrolysis of ATP to [...]
CCG46783.1 protein networkhttps://string-db.org/network/866895.HBHAL_4443Hypothetical protein.
CCG46784.1 protein networkhttps://string-db.org/network/866895.HBHAL_4444Alkaline serine protease, subtilase family; Belongs to the peptidase S8 family.
CCG46785.1 protein networkhttps://string-db.org/network/866895.HBHAL_4445Putative S-layer protein.
CCG46786.1 protein networkhttps://string-db.org/network/866895.HBHAL_4446Hypothetical protein.
CCG46787.1 protein networkhttps://string-db.org/network/866895.HBHAL_44475'-nucleotidase precursor; Belongs to the 5'-nucleotidase family.
CCG46789.1 protein networkhttps://string-db.org/network/866895.HBHAL_4449Extracellular alkaline serine protease.
CCG46790.1 protein networkhttps://string-db.org/network/866895.HBHAL_4450Probable N-acetylmuramoyl-L-alanine amidase.
CCG46791.1 protein networkhttps://string-db.org/network/866895.HBHAL_4451S-layer protein / peptidoglycan endo-beta-N-acetylglucosaminidase.
CCG46792.1 protein networkhttps://string-db.org/network/866895.HBHAL_4452Putative teichoic acid biosynthesis protein A; Catalyzes the conversion of GlcNAc-PP-undecaprenol into ManNAc-GlcNAc-PP-undecaprenol, the first committed lipid intermediate in the de novo synthes [...]
CCG46793.1 protein networkhttps://string-db.org/network/866895.HBHAL_4453Polysaccharide biosynthesis protein.
CCG46794.1 protein networkhttps://string-db.org/network/866895.HBHAL_4454Conserved hypothetical protein.
CCG46795.1 protein networkhttps://string-db.org/network/866895.HBHAL_4455Polysaccharide pyruvyl transferase.
CCG46796.1 protein networkhttps://string-db.org/network/866895.HBHAL_4456Hypothetical protein.
CCG46797.1 protein networkhttps://string-db.org/network/866895.HBHAL_4457Methyl-accepting chemotaxis protein.
CCG46798.1 protein networkhttps://string-db.org/network/866895.HBHAL_4458Hypothetical protein.
CCG46799.1 protein networkhttps://string-db.org/network/866895.HBHAL_4459Hypothetical protein.
CCG46801.1 protein networkhttps://string-db.org/network/866895.HBHAL_4461Hypothetical protein.
CCG46802.1 protein networkhttps://string-db.org/network/866895.HBHAL_4462Hypothetical protein.
CCG46803.1 protein networkhttps://string-db.org/network/866895.HBHAL_4463BNR repeat domain protein.
copZ2 protein networkhttps://string-db.org/network/866895.HBHAL_4464Copper chaperone CopZ.
CCG46805.1 protein networkhttps://string-db.org/network/866895.HBHAL_4465Conserved hypothetical protein.
CCG46806.1 protein networkhttps://string-db.org/network/866895.HBHAL_4466Hypothetical protein.
CCG46807.1 protein networkhttps://string-db.org/network/866895.HBHAL_4467Hypothetical protein.
CCG46808.1 protein networkhttps://string-db.org/network/866895.HBHAL_4468Glycosyltransferase WecB/TagA/CpsF family; Catalyzes the conversion of GlcNAc-PP-undecaprenol into ManNAc-GlcNAc-PP-undecaprenol, the first committed lipid intermediate in the de novo synthesis o [...]
CCG46809.1 protein networkhttps://string-db.org/network/866895.HBHAL_4469UDP-glucose/GDP-mannose dehydrogenase; Belongs to the UDP-glucose/GDP-mannose dehydrogenase family.
CCG46810.1 protein networkhttps://string-db.org/network/866895.HBHAL_4470Hypothetical protein.
mviN protein networkhttps://string-db.org/network/866895.HBHAL_4471Integral membrane protein MviN; Involved in peptidoglycan biosynthesis. Transports lipid- linked peptidoglycan precursors from the inner to the outer leaflet of the cytoplasmic membrane.
CCG46812.1 protein networkhttps://string-db.org/network/866895.HBHAL_4472Group 1 glycosyltransferase.
CCG46813.1 protein networkhttps://string-db.org/network/866895.HBHAL_4473Hypothetical protein.
CCG46814.1 protein networkhttps://string-db.org/network/866895.HBHAL_4474Hypothetical protein.
CCG46815.1 protein networkhttps://string-db.org/network/866895.HBHAL_4475Hypothetical protein.
CCG46816.1 protein networkhttps://string-db.org/network/866895.HBHAL_4476Hypothetical protein.
CCG46817.1 protein networkhttps://string-db.org/network/866895.HBHAL_4477Hypothetical protein.
CCG46818.1 protein networkhttps://string-db.org/network/866895.HBHAL_4478Hypothetical protein.
CCG46819.1 protein networkhttps://string-db.org/network/866895.HBHAL_4479Amidohydrolase family protein.
CCG46820.1 protein networkhttps://string-db.org/network/866895.HBHAL_4480Hypothetical protein.
CCG46821.1 protein networkhttps://string-db.org/network/866895.HBHAL_4481Chromate transporter.
CCG46822.1 protein networkhttps://string-db.org/network/866895.HBHAL_4482PadR family transcription regulator.
CCG46823.1 protein networkhttps://string-db.org/network/866895.HBHAL_4483MFS-type transporter.
tagO2 protein networkhttps://string-db.org/network/866895.HBHAL_4485Probable undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase.
CCG46827.1 protein networkhttps://string-db.org/network/866895.HBHAL_4487Hypothetical protein.
CCG46828.1 protein networkhttps://string-db.org/network/866895.HBHAL_4488Hypothetical protein.
CCG46829.1 protein networkhttps://string-db.org/network/866895.HBHAL_4489SinR/xre family transcription regulator.
CCG46830.1 protein networkhttps://string-db.org/network/866895.HBHAL_4490Hypothetical protein.
CCG46831.1 protein networkhttps://string-db.org/network/866895.HBHAL_4491AraC family transcription regulator.
CCG46832.1 protein networkhttps://string-db.org/network/866895.HBHAL_4492Hypothetical protein.
CCG46833.1 protein networkhttps://string-db.org/network/866895.HBHAL_4493Conserved hypothetical protein.
CCG46834.1 protein networkhttps://string-db.org/network/866895.HBHAL_4494Phosphoglucomutase/phosphomannomutase family protein.
CCG46835.1 protein networkhttps://string-db.org/network/866895.HBHAL_4495Mannose-6-phosphate isomerase; Belongs to the mannose-6-phosphate isomerase type 1 family.
CCG46836.1 protein networkhttps://string-db.org/network/866895.HBHAL_4496PTS system subunit IIABC, sucrose-specific.
CCG46837.1 protein networkhttps://string-db.org/network/866895.HBHAL_4497LacI family transcription regulator.
CCG46838.1 protein networkhttps://string-db.org/network/866895.HBHAL_4498Hypothetical protein.
hom1 protein networkhttps://string-db.org/network/866895.HBHAL_4499Homoserine dehydrogenase.
thrC2 protein networkhttps://string-db.org/network/866895.HBHAL_4500Threonine synthase; Catalyzes the gamma-elimination of phosphate from L- phosphohomoserine and the beta-addition of water to produce L- threonine.
thrB protein networkhttps://string-db.org/network/866895.HBHAL_4501Homoserine kinase; Catalyzes the ATP-dependent phosphorylation of L-homoserine to L-homoserine phosphate; Belongs to the GHMP kinase family. Homoserine kinase subfamily.
CCG46842.1 protein networkhttps://string-db.org/network/866895.HBHAL_4502Hypothetical protein.
CCG46843.1 protein networkhttps://string-db.org/network/866895.HBHAL_4503Hypothetical protein.
CCG46844.1 protein networkhttps://string-db.org/network/866895.HBHAL_4504Hypothetical protein.
CCG46845.1 protein networkhttps://string-db.org/network/866895.HBHAL_4505Hypothetical protein; Belongs to the sigma-70 factor family. ECF subfamily.
CCG46846.1 protein networkhttps://string-db.org/network/866895.HBHAL_4506Hypothetical protein.
CCG46847.1 protein networkhttps://string-db.org/network/866895.HBHAL_4507Hypothetical protein.
CCG46848.1 protein networkhttps://string-db.org/network/866895.HBHAL_4508Hypothetical protein.
CCG46849.1 protein networkhttps://string-db.org/network/866895.HBHAL_4509Probable transport protein.
CCG46850.1 protein networkhttps://string-db.org/network/866895.HBHAL_4510DUF1568 family protein.
gnd protein networkhttps://string-db.org/network/866895.HBHAL_45116-phosphogluconate dehydrogenase-like protein.
CCG46852.1 protein networkhttps://string-db.org/network/866895.HBHAL_4512RpiR family transcription regulator.
CCG46853.1 protein networkhttps://string-db.org/network/866895.HBHAL_4513SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
CCG46854.1 protein networkhttps://string-db.org/network/866895.HBHAL_4514Conserved hypothetical protein.
CCG46855.1 protein networkhttps://string-db.org/network/866895.HBHAL_4515Hypothetical protein.
CCG46856.1 protein networkhttps://string-db.org/network/866895.HBHAL_4516M15 family peptidase.
CCG46857.1 protein networkhttps://string-db.org/network/866895.HBHAL_4517Hypothetical protein.
CCG46858.1 protein networkhttps://string-db.org/network/866895.HBHAL_4518Glycoside hydrolase, family 2, sugar binding; Belongs to the glycosyl hydrolase 2 family.
CCG46859.1 protein networkhttps://string-db.org/network/866895.HBHAL_4519Sodium/galactoside symporter family protein.
CCG46860.1 protein networkhttps://string-db.org/network/866895.HBHAL_4520ArsR family transcription regulator.
CCG46862.1 protein networkhttps://string-db.org/network/866895.HBHAL_4522Bile acid/sodium symporter (BASS) family protein.
glcD2 protein networkhttps://string-db.org/network/866895.HBHAL_4523Glycolate oxidase subunit GlcD.
CCG46864.1 protein networkhttps://string-db.org/network/866895.HBHAL_4524Conserved hypothetical protein.
frnE protein networkhttps://string-db.org/network/866895.HBHAL_4525FrnE protein.
glcF protein networkhttps://string-db.org/network/866895.HBHAL_4526Glycolate oxidase iron-sulfur subunit.
glcD1 protein networkhttps://string-db.org/network/866895.HBHAL_4527Glycolate oxidase subunit GlcD.
npr3 protein networkhttps://string-db.org/network/866895.HBHAL_4528Neutral protease; Extracellular zinc metalloprotease.
lacZ protein networkhttps://string-db.org/network/866895.HBHAL_4531Beta-galactosidase.
CCG46870.1 protein networkhttps://string-db.org/network/866895.HBHAL_4532Conserved hypothetical protein.
galT protein networkhttps://string-db.org/network/866895.HBHAL_4533Galactose-1-phosphate uridylyltransferase.
galE3 protein networkhttps://string-db.org/network/866895.HBHAL_4534UDP-glucose 4-epimerase; Belongs to the NAD(P)-dependent epimerase/dehydratase family.
galK protein networkhttps://string-db.org/network/866895.HBHAL_4535Galactokinase; Catalyzes the transfer of the gamma-phosphate of ATP to D- galactose to form alpha-D-galactose-1-phosphate (Gal-1-P). Belongs to the GHMP kinase family. GalK subfamily.
aga protein networkhttps://string-db.org/network/866895.HBHAL_4536Alpha-galactosidase.
CCG46875.1 protein networkhttps://string-db.org/network/866895.HBHAL_4537ABC-type transport system permease protein (probable substrate sugar/lactose/L-arabinose).
CCG46876.1 protein networkhttps://string-db.org/network/866895.HBHAL_4538ABC-type transport system permease protein (probable substrate sugar/lactose/L-arabinose).
CCG46877.1 protein networkhttps://string-db.org/network/866895.HBHAL_4539ABC-type transport system extracellular binding protein (probable substrate sugar/lactose/L-arabinose).
CCG46878.1 protein networkhttps://string-db.org/network/866895.HBHAL_4540ROK family protein.
CCG46879.1 protein networkhttps://string-db.org/network/866895.HBHAL_4541Hypothetical protein.
CCG46880.1 protein networkhttps://string-db.org/network/866895.HBHAL_4542ROK family protein.
CCG46881.1 protein networkhttps://string-db.org/network/866895.HBHAL_4543LytR family transcription regulator.
CCG46882.1 protein networkhttps://string-db.org/network/866895.HBHAL_4544Small membrane protein.
CCG46883.1 protein networkhttps://string-db.org/network/866895.HBHAL_4545Hypothetical protein.
CCG46884.1 protein networkhttps://string-db.org/network/866895.HBHAL_4546Cytosolic long-chain acyl-CoA thioester hydrolase family protein.
CCG46885.1 protein networkhttps://string-db.org/network/866895.HBHAL_4547LysR family transcription regulator; Belongs to the LysR transcriptional regulatory family.
CCG46886.1 protein networkhttps://string-db.org/network/866895.HBHAL_4548Cation transporter.
CCG46887.1 protein networkhttps://string-db.org/network/866895.HBHAL_4549Group 2 glycosyltransferase.
CCG46888.1 protein networkhttps://string-db.org/network/866895.HBHAL_4550Conserved hypothetical protein.
CCG46889.1 protein networkhttps://string-db.org/network/866895.HBHAL_4551Conserved hypothetical protein.
CCG46890.1 protein networkhttps://string-db.org/network/866895.HBHAL_4552Probable permease.
CCG46891.1 protein networkhttps://string-db.org/network/866895.HBHAL_4553Hypothetical protein.
CCG46892.1 protein networkhttps://string-db.org/network/866895.HBHAL_4554Hypothetical protein.
CCG46893.1 protein networkhttps://string-db.org/network/866895.HBHAL_4555Oxidoreductase domain protein.
CCG46894.1 protein networkhttps://string-db.org/network/866895.HBHAL_4556Oxidoreductase domain protein.
CCG46895.1 protein networkhttps://string-db.org/network/866895.HBHAL_4557Hypothetical protein.
CCG46896.1 protein networkhttps://string-db.org/network/866895.HBHAL_4558LacI family transcription regulator.
CCG46897.1 protein networkhttps://string-db.org/network/866895.HBHAL_4559ABC-type transport system permease protein (probable substrate sugar).
CCG46898.1 protein networkhttps://string-db.org/network/866895.HBHAL_4560ABC-type transport system permease protein (probable substrate sugar).
CCG46899.1 protein networkhttps://string-db.org/network/866895.HBHAL_4561ABC-type transport system extracellular binding protein (probable substrate sugar).
ibpA protein networkhttps://string-db.org/network/866895.HBHAL_4562Small heat shock protein; Belongs to the small heat shock protein (HSP20) family.
CCG46901.1 protein networkhttps://string-db.org/network/866895.HBHAL_4563Hypothetical protein.
CCG46902.1 protein networkhttps://string-db.org/network/866895.HBHAL_4564Hypothetical protein.
CCG46903.1 protein networkhttps://string-db.org/network/866895.HBHAL_4565Hypothetical protein.
CCG46904.1 protein networkhttps://string-db.org/network/866895.HBHAL_4566Hypothetical protein.
CCG46905.1 protein networkhttps://string-db.org/network/866895.HBHAL_4567Hypothetical protein.
CCG46906.1 protein networkhttps://string-db.org/network/866895.HBHAL_4569Hypothetical protein.
CCG46907.1 protein networkhttps://string-db.org/network/866895.HBHAL_4569_AHypothetical protein.
CCG46908.1 protein networkhttps://string-db.org/network/866895.HBHAL_4570Xylose isomerase domain protein.
CCG46909.1 protein networkhttps://string-db.org/network/866895.HBHAL_4571SinR/xre family transcription regulator.
CCG46910.1 protein networkhttps://string-db.org/network/866895.HBHAL_4572CBS domain protein.
CCG46911.1 protein networkhttps://string-db.org/network/866895.HBHAL_4573ABC-type transport system ATP-binding/permease protein.
CCG46912.1 protein networkhttps://string-db.org/network/866895.HBHAL_4574Hypothetical protein.
CCG46913.1 protein networkhttps://string-db.org/network/866895.HBHAL_4575Peptidase C60 sortase A and B.
CCG46914.1 protein networkhttps://string-db.org/network/866895.HBHAL_4576Hypothetical protein.
acrB protein networkhttps://string-db.org/network/866895.HBHAL_4577Acriflavin resistance protein family transporter subunit AcrB; Belongs to the resistance-nodulation-cell division (RND) (TC 2.A.6) family.
acrA protein networkhttps://string-db.org/network/866895.HBHAL_4578Acriflavin resistance protein family transporter subunit AcrA; Belongs to the membrane fusion protein (MFP) (TC 8.A.1) family.
CCG46917.1 protein networkhttps://string-db.org/network/866895.HBHAL_4579Hypothetical protein.
CCG46918.1 protein networkhttps://string-db.org/network/866895.HBHAL_4580Hypothetical protein.
CCG46919.1 protein networkhttps://string-db.org/network/866895.HBHAL_4581Subtilisin-like serine protease.
fabZ protein networkhttps://string-db.org/network/866895.HBHAL_4582(3R)-hydroxymyristoyl-(acyl carrier protein) dehydratase; Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated [...]
CCG46921.1 protein networkhttps://string-db.org/network/866895.HBHAL_4583Conserved hypothetical protein.
CCG46922.1 protein networkhttps://string-db.org/network/866895.HBHAL_4584FAD-dependent oxidoreductase.
CCG46923.1 protein networkhttps://string-db.org/network/866895.HBHAL_4585Hypothetical protein.
flhP protein networkhttps://string-db.org/network/866895.HBHAL_4586Flagellar hook-basal body protein.
flhO protein networkhttps://string-db.org/network/866895.HBHAL_4587Flagellar basal body rod protein.
mbl protein networkhttps://string-db.org/network/866895.HBHAL_4588Rod shape-determining protein Mbl.
CCG46927.1 protein networkhttps://string-db.org/network/866895.HBHAL_4589Stage III sporulation protein D.
spoIIQ protein networkhttps://string-db.org/network/866895.HBHAL_4590Stage II sporulation protein SpoIIQ.
CCG46929.1 protein networkhttps://string-db.org/network/866895.HBHAL_4591Stage II sporulation protein D.
murA1 protein networkhttps://string-db.org/network/866895.HBHAL_4592UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Cell wall formation. Adds enolpyruvyl to UDP-N- acetylglucosamine; Belongs to the EPSP synthase family. MurA subfamily.
ywmB protein networkhttps://string-db.org/network/866895.HBHAL_4593Hypothetical protein.
CCG46932.1 protein networkhttps://string-db.org/network/866895.HBHAL_4594Hypothetical protein.
atpC protein networkhttps://string-db.org/network/866895.HBHAL_4595F0F1 ATP synthase epsilon subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane.
atpD protein networkhttps://string-db.org/network/866895.HBHAL_4596F0F1 ATP synthase beta subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits; Belongs to the ATPas [...]
atpG protein networkhttps://string-db.org/network/866895.HBHAL_4597F0F1 ATP synthase gamma subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the [...]
atpA protein networkhttps://string-db.org/network/866895.HBHAL_4598F0F1 ATP synthase alpha subunit; Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit. Belongs to the ATPase alpha/beta chains f [...]
atpH protein networkhttps://string-db.org/network/866895.HBHAL_4599F0F1 ATP synthase delta subunit; F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the [...]
atpF protein networkhttps://string-db.org/network/866895.HBHAL_4600F0F1 ATP synthase subunit B; Component of the F(0) channel, it forms part of the peripheral stalk, linking F(1) to F(0); Belongs to the ATPase B chain family.
atpE protein networkhttps://string-db.org/network/866895.HBHAL_4601F0F1 ATP synthase subunit C; F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extr [...]
atpB protein networkhttps://string-db.org/network/866895.HBHAL_4602F0F1 ATP synthase subunit A; Key component of the proton channel; it plays a direct role in the translocation of protons across the membrane.
atpI protein networkhttps://string-db.org/network/866895.HBHAL_4603F0F1 ATP synthase subunit I.
CCG46942.1 protein networkhttps://string-db.org/network/866895.HBHAL_4604Hypothetical protein.
vpr protein networkhttps://string-db.org/network/866895.HBHAL_4605Minor extracellular serine protease; Belongs to the peptidase S8 family.
mnaA protein networkhttps://string-db.org/network/866895.HBHAL_4606UDP-N-acetylglucosamine 2-epimerase; Belongs to the UDP-N-acetylglucosamine 2-epimerase family.
upp protein networkhttps://string-db.org/network/866895.HBHAL_4607Uracil phosphoribosyltransferase; Catalyzes the conversion of uracil and 5-phospho-alpha-D- ribose 1-diphosphate (PRPP) to UMP and diphosphate.
CCG46946.1 protein networkhttps://string-db.org/network/866895.HBHAL_4608Hypothetical protein.
glyA protein networkhttps://string-db.org/network/866895.HBHAL_4609Serine hydroxymethyltransferase; Catalyzes the reversible interconversion of serine and glycine with tetrahydrofolate (THF) serving as the one-carbon carrier. This reaction serves as the major so [...]
ywlG protein networkhttps://string-db.org/network/866895.HBHAL_4610Hypothetical protein; Belongs to the UPF0340 family.
ywlF protein networkhttps://string-db.org/network/866895.HBHAL_4611Ribose-5-phosphate isomerase.
ywlE protein networkhttps://string-db.org/network/866895.HBHAL_4612Protein-tyrosine-phosphatase; Belongs to the low molecular weight phosphotyrosine protein phosphatase family.
CCG46951.1 protein networkhttps://string-db.org/network/866895.HBHAL_4613Hypothetical protein; Probably functions as a manganese efflux pump.
CCG46952.1 protein networkhttps://string-db.org/network/866895.HBHAL_4614tRNA threonylcarbamoyladenosine biosynthesis protein; Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenin [...]
CCG46953.1 protein networkhttps://string-db.org/network/866895.HBHAL_4615Hypothetical protein.
CCG46954.1 protein networkhttps://string-db.org/network/866895.HBHAL_4616Stage II sporulation protein R.
prmC protein networkhttps://string-db.org/network/866895.HBHAL_4617Protoporphyrinogen oxidase; Methylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif; Belongs to the pr [...]
prfA protein networkhttps://string-db.org/network/866895.HBHAL_4618Peptide chain release factor RF1; Peptide chain release factor 1 directs the termination of translation in response to the peptide chain termination codons UAG and UAA.
CCG46957.1 protein networkhttps://string-db.org/network/866895.HBHAL_4619Hypothetical protein.
CCG46958.1 protein networkhttps://string-db.org/network/866895.HBHAL_4620Hypothetical protein.
CCG46959.1 protein networkhttps://string-db.org/network/866895.HBHAL_4621Hypothetical protein.
CCG46960.1 protein networkhttps://string-db.org/network/866895.HBHAL_4622Hypothetical protein.
tdk protein networkhttps://string-db.org/network/866895.HBHAL_4623Thymidine kinase.
CCG46962.1 protein networkhttps://string-db.org/network/866895.HBHAL_4624Hypothetical protein.
rpmE protein networkhttps://string-db.org/network/866895.HBHAL_462550S ribosomal protein L31 type B.
rho protein networkhttps://string-db.org/network/866895.HBHAL_4626Transcription termination factor Rho; Facilitates transcription termination by a mechanism that involves Rho binding to the nascent RNA, activation of Rho's RNA- dependent ATPase activity, and re [...]
CCG46965.1 protein networkhttps://string-db.org/network/866895.HBHAL_4627Hypothetical protein.
murA2 protein networkhttps://string-db.org/network/866895.HBHAL_4628UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Cell wall formation. Adds enolpyruvyl to UDP-N- acetylglucosamine; Belongs to the EPSP synthase family. MurA subfamily.
tal protein networkhttps://string-db.org/network/866895.HBHAL_4629Putative translaldolase; Transaldolase is important for the balance of metabolites in the pentose-phosphate pathway; Belongs to the transaldolase family. Type 3B subfamily.
fbaA protein networkhttps://string-db.org/network/866895.HBHAL_4630Fructose 1,6-bisphosphate aldolase.
CCG46969.1 protein networkhttps://string-db.org/network/866895.HBHAL_4631Two-component response regulator.
pyrG protein networkhttps://string-db.org/network/866895.HBHAL_4633CTP synthetase; Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Regulates intracellular CTP levels through interactions with the [...]
rpoE protein networkhttps://string-db.org/network/866895.HBHAL_4634DNA-directed RNA polymerase delta subunit; Participates in both the initiation and recycling phases of transcription. In the presence of the delta subunit, RNAP displays an increased specificity [...]
mcm1 protein networkhttps://string-db.org/network/866895.HBHAL_4636methylmalonyl-CoA mutase; Catalyzes the reversible interconversion of isobutyryl-CoA and n-butyryl-CoA, using radical chemistry. Also exhibits GTPase activity, associated with its G-protein domai [...]
CCG46975.1 protein networkhttps://string-db.org/network/866895.HBHAL_4637TetR family transcription regulator.
CCG46976.1 protein networkhttps://string-db.org/network/866895.HBHAL_4638LAO/AO-type transport system ATPase.
CCG46977.1 protein networkhttps://string-db.org/network/866895.HBHAL_4639acyl-CoA dehydrogenase.
CCG46978.1 protein networkhttps://string-db.org/network/866895.HBHAL_4640acyl-CoA dehydrogenase.
hbd protein networkhttps://string-db.org/network/866895.HBHAL_46413-hydroxybutyryl-CoA dehydrogenase.
CCG46980.1 protein networkhttps://string-db.org/network/866895.HBHAL_4642acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family.
CCG46981.1 protein networkhttps://string-db.org/network/866895.HBHAL_4643Ferredoxin, 4Fe-4S.
cls3 protein networkhttps://string-db.org/network/866895.HBHAL_4644Homolog to cardiolipin synthetase; Belongs to the phospholipase D family. Cardiolipin synthase subfamily.
CCG46983.1 protein networkhttps://string-db.org/network/866895.HBHAL_4645Hypothetical protein.
argS2 protein networkhttps://string-db.org/network/866895.HBHAL_4646arginyl-tRNA synthetase.
CCG46985.1 protein networkhttps://string-db.org/network/866895.HBHAL_4647Conserved hypothetical protein.
CCG46986.1 protein networkhttps://string-db.org/network/866895.HBHAL_4648Hypothetical protein.
speB protein networkhttps://string-db.org/network/866895.HBHAL_4649Agmatinase; Belongs to the arginase family.
speE2 protein networkhttps://string-db.org/network/866895.HBHAL_4650Spermidine synthase; Catalyzes the irreversible transfer of a propylamine group from the amino donor S-adenosylmethioninamine (decarboxy-AdoMet) to putrescine (1,4-diaminobutane) to yield spermid [...]
pbpG protein networkhttps://string-db.org/network/866895.HBHAL_4651Penicillin binding protein 2D.
CCG46990.1 protein networkhttps://string-db.org/network/866895.HBHAL_4652Hypothetical protein.
ywhD protein networkhttps://string-db.org/network/866895.HBHAL_4653Hypothetical protein.
CCG46992.1 protein networkhttps://string-db.org/network/866895.HBHAL_4654ABC-type transport system permease protein.
ywgA protein networkhttps://string-db.org/network/866895.HBHAL_4655Conserved hypothetical protein.
CCG46994.1 protein networkhttps://string-db.org/network/866895.HBHAL_4656Conserved hypothetical protein.
lipL protein networkhttps://string-db.org/network/866895.HBHAL_4657Putative lipoate-protein ligase A; Catalyzes the amidotransfer (transamidation) of the octanoyl moiety from octanoyl-GcvH to the lipoyl domain of the E2 subunit of lipoate-dependent enzymes; Belo [...]
eutD protein networkhttps://string-db.org/network/866895.HBHAL_4658Phosphate acetyltransferase.
CCG46997.1 protein networkhttps://string-db.org/network/866895.HBHAL_4659Conserved hypothetical protein; May function as heme-dependent peroxidase.
cwlJ2 protein networkhttps://string-db.org/network/866895.HBHAL_4660Cell wall hydrolase CwlJ.
gerQ protein networkhttps://string-db.org/network/866895.HBHAL_4661Spore coat protein GerQ.
CCG47000.1 protein networkhttps://string-db.org/network/866895.HBHAL_4662Hypothetical protein.
CCG47001.1 protein networkhttps://string-db.org/network/866895.HBHAL_4663Hypothetical protein.
CCG47002.1 protein networkhttps://string-db.org/network/866895.HBHAL_4664Hypothetical protein.
CCG47003.1 protein networkhttps://string-db.org/network/866895.HBHAL_4665Sodium-dependent transporter.
CCG47004.1 protein networkhttps://string-db.org/network/866895.HBHAL_4666ABC-type transport system permease protein.
CCG47005.1 protein networkhttps://string-db.org/network/866895.HBHAL_4667Hypothetical protein.
aarF protein networkhttps://string-db.org/network/866895.HBHAL_4668ABC-1 domain protein.
CCG47007.1 protein networkhttps://string-db.org/network/866895.HBHAL_4669Acetyltransferase, GNAT family.
CCG47008.1 protein networkhttps://string-db.org/network/866895.HBHAL_4670Homolog to fructosamine kinase.
CCG47009.1 protein networkhttps://string-db.org/network/866895.HBHAL_4671Hypothetical protein.
CCG47010.1 protein networkhttps://string-db.org/network/866895.HBHAL_4672Hypothetical protein.
CCG47011.1 protein networkhttps://string-db.org/network/866895.HBHAL_4673ThiJ/PfpI domain protein.
ykrP protein networkhttps://string-db.org/network/866895.HBHAL_4674Hypothetical protein.
ampS1 protein networkhttps://string-db.org/network/866895.HBHAL_4675M29 family aminopeptidase.
CCG47014.1 protein networkhttps://string-db.org/network/866895.HBHAL_4676Conserved hypothetical protein.
phrB protein networkhttps://string-db.org/network/866895.HBHAL_4677Deoxyribodipyrimidine photo-lyase; Belongs to the DNA photolyase family.
ribH protein networkhttps://string-db.org/network/866895.HBHAL_4678Riboflavin synthase beta subunit; Catalyzes the formation of 6,7-dimethyl-8-ribityllumazine by condensation of 5-amino-6-(D-ribitylamino)uracil with 3,4-dihydroxy-2- butanone 4-phosphate. This is [...]
ribA protein networkhttps://string-db.org/network/866895.HBHAL_4679Bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase / GTP cyclohydrolase II protein; Catalyzes the conversion of D-ribulose 5-phosphate to formate and 3,4-dihydroxy-2-butanone 4-phosphate; [...]
ribE protein networkhttps://string-db.org/network/866895.HBHAL_4680Riboflavin synthase alpha subunit.
CCG47019.1 protein networkhttps://string-db.org/network/866895.HBHAL_4681Riboflavin biosynthesis protein RibD; Converts 2,5-diamino-6-(ribosylamino)-4(3h)-pyrimidinone 5'- phosphate into 5-amino-6-(ribosylamino)-2,4(1h,3h)-pyrimidinedione 5'- phosphate; In the C-termi [...]
CCG47020.1 protein networkhttps://string-db.org/network/866895.HBHAL_4682Hypothetical protein.
CCG47021.1 protein networkhttps://string-db.org/network/866895.HBHAL_4683Hypothetical protein.
CCG47022.1 protein networkhttps://string-db.org/network/866895.HBHAL_4684Hypothetical protein.
CCG47023.1 protein networkhttps://string-db.org/network/866895.HBHAL_4685Hypothetical protein.
CCG47024.1 protein networkhttps://string-db.org/network/866895.HBHAL_4686UvrD/REP helicase family protein.
CCG47025.1 protein networkhttps://string-db.org/network/866895.HBHAL_4687Conserved hypothetical protein.
HBHAL_4691 protein networkhttps://string-db.org/network/866895.HBHAL_4691Conserved hypothetical protein (nonfunctional).
CCG47030.1 protein networkhttps://string-db.org/network/866895.HBHAL_4692Conserved hypothetical protein.
CCG47031.1 protein networkhttps://string-db.org/network/866895.HBHAL_4693Conserved hypothetical protein.
CCG47032.1 protein networkhttps://string-db.org/network/866895.HBHAL_4694Conserved hypothetical protein.
CCG47033.1 protein networkhttps://string-db.org/network/866895.HBHAL_4695Conserved hypothetical protein.
CCG47034.1 protein networkhttps://string-db.org/network/866895.HBHAL_4696Conserved hypothetical protein.
CCG47035.1 protein networkhttps://string-db.org/network/866895.HBHAL_4697Conserved hypothetical protein.
CCG47036.1 protein networkhttps://string-db.org/network/866895.HBHAL_4698Conserved hypothetical protein.
CCG47037.1 protein networkhttps://string-db.org/network/866895.HBHAL_4699Conserved hypothetical protein.
CCG47038.1 protein networkhttps://string-db.org/network/866895.HBHAL_4700Conserved hypothetical protein.
CCG47039.1 protein networkhttps://string-db.org/network/866895.HBHAL_4701Conserved hypothetical protein.
CCG47040.1 protein networkhttps://string-db.org/network/866895.HBHAL_4702Conserved hypothetical protein.
CCG47041.1 protein networkhttps://string-db.org/network/866895.HBHAL_4703Conserved hypothetical protein.
CCG47042.1 protein networkhttps://string-db.org/network/866895.HBHAL_4704Conserved hypothetical protein.
CCG47043.1 protein networkhttps://string-db.org/network/866895.HBHAL_4705Conserved hypothetical protein.
CCG47044.1 protein networkhttps://string-db.org/network/866895.HBHAL_4706Conserved hypothetical protein.
CCG47045.1 protein networkhttps://string-db.org/network/866895.HBHAL_4707Conserved hypothetical protein.
CCG47046.1 protein networkhttps://string-db.org/network/866895.HBHAL_4708Conserved hypothetical protein.
CCG47047.1 protein networkhttps://string-db.org/network/866895.HBHAL_4709Conserved hypothetical protein.
CCG47048.1 protein networkhttps://string-db.org/network/866895.HBHAL_4710Conserved hypothetical protein.
CCG47049.1 protein networkhttps://string-db.org/network/866895.HBHAL_4711Conserved hypothetical protein.
CCG47050.1 protein networkhttps://string-db.org/network/866895.HBHAL_4712Conserved hypothetical protein.
CCG47051.1 protein networkhttps://string-db.org/network/866895.HBHAL_4713DnaD domain protein.
CCG47052.1 protein networkhttps://string-db.org/network/866895.HBHAL_4714HTH domain protein.
CCG47053.1 protein networkhttps://string-db.org/network/866895.HBHAL_4715Conserved hypothetical protein.
CCG47054.1 protein networkhttps://string-db.org/network/866895.HBHAL_4716HTH domain protein.
CCG47055.1 protein networkhttps://string-db.org/network/866895.HBHAL_4717SinR/xre family transcription regulator.
CCG47056.1 protein networkhttps://string-db.org/network/866895.HBHAL_4718Hypothetical protein.
CCG47057.1 protein networkhttps://string-db.org/network/866895.HBHAL_4719Hypothetical protein.
CCG47058.1 protein networkhttps://string-db.org/network/866895.HBHAL_4720Hypothetical protein.
CCG47059.1 protein networkhttps://string-db.org/network/866895.HBHAL_4721Conserved hypothetical protein.
CCG47060.1 protein networkhttps://string-db.org/network/866895.HBHAL_4722Hypothetical protein.
CCG47061.1 protein networkhttps://string-db.org/network/866895.HBHAL_4723PadR family transcription regulator.
CCG47062.1 protein networkhttps://string-db.org/network/866895.HBHAL_4724Hypothetical protein.
CCG47063.1 protein networkhttps://string-db.org/network/866895.HBHAL_4725Hypothetical protein.
CCG47066.1 protein networkhttps://string-db.org/network/866895.HBHAL_4728Conserved hypothetical protein.
CCG47067.1 protein networkhttps://string-db.org/network/866895.HBHAL_4729Phage integrase domain protein; Belongs to the 'phage' integrase family.
CCG47068.1 protein networkhttps://string-db.org/network/866895.HBHAL_4730Hypothetical protein.
HBHAL_4732 protein networkhttps://string-db.org/network/866895.HBHAL_4732Locus_tag: HBHAL_4731; product: AB hydrolase superfamily protein (nonfunctional); gene has been targetted by a transposon; conceptual translation after in silico reconstruction: MYYTSSGAGVPIVFIHP [...]
CCG47071.1 protein networkhttps://string-db.org/network/866895.HBHAL_4733Hypothetical protein.
CCG47072.1 protein networkhttps://string-db.org/network/866895.HBHAL_4734Hypothetical protein.
CCG47073.1 protein networkhttps://string-db.org/network/866895.HBHAL_4735Hypothetical protein.
CCG47074.1 protein networkhttps://string-db.org/network/866895.HBHAL_4736Conserved hypothetical protein.
CCG47075.1 protein networkhttps://string-db.org/network/866895.HBHAL_4737Hypothetical protein.
CCG47076.1 protein networkhttps://string-db.org/network/866895.HBHAL_4738Spore coat protein.
uvrX protein networkhttps://string-db.org/network/866895.HBHAL_4739Probable UV-damage repair protein uvrX; Belongs to the DNA polymerase type-Y family.
malL3 protein networkhttps://string-db.org/network/866895.HBHAL_4740Oligo-1,6-glucosidase.
ymaD protein networkhttps://string-db.org/network/866895.HBHAL_4741Hypothetical protein.
CCG47080.1 protein networkhttps://string-db.org/network/866895.HBHAL_4742Conserved hypothetical protein.
CCG47081.1 protein networkhttps://string-db.org/network/866895.HBHAL_4743Acetyltransferase, GNAT family.
CCG47082.1 protein networkhttps://string-db.org/network/866895.HBHAL_4744Conserved hypothetical protein.
CCG47083.1 protein networkhttps://string-db.org/network/866895.HBHAL_4745Hypothetical protein.
ykoY3 protein networkhttps://string-db.org/network/866895.HBHAL_4746TerC family protein.
CCG47085.1 protein networkhttps://string-db.org/network/866895.HBHAL_4747Hypothetical protein.
pepT protein networkhttps://string-db.org/network/866895.HBHAL_4748Peptidase T; Cleaves the N-terminal amino acid of tripeptides. Belongs to the peptidase M20B family.
CCG47087.1 protein networkhttps://string-db.org/network/866895.HBHAL_4749UPF0118 family protein.
CCG47088.1 protein networkhttps://string-db.org/network/866895.HBHAL_4750MFS-type transporter.
dctP2 protein networkhttps://string-db.org/network/866895.HBHAL_4751TRAP-T type transporter subunit DctP.
dctM2 protein networkhttps://string-db.org/network/866895.HBHAL_4752TRAP-T type transporter subunit DctM.
dctQ2 protein networkhttps://string-db.org/network/866895.HBHAL_4753TRAP-T type transporter subunit DctQ.
CCG47092.1 protein networkhttps://string-db.org/network/866895.HBHAL_4754Acetyltransferase, GNAT family.
CCG47093.1 protein networkhttps://string-db.org/network/866895.HBHAL_4755Hypothetical protein.
CCG47094.1 protein networkhttps://string-db.org/network/866895.HBHAL_4756Na+/H+ antiporter family protein.
CCG47095.1 protein networkhttps://string-db.org/network/866895.HBHAL_4757Branched-chain amino acid transport system II carrier family protein; Component of the transport system for branched-chain amino acids.
CCG47096.1 protein networkhttps://string-db.org/network/866895.HBHAL_4758Hypothetical protein.
CCG47097.1 protein networkhttps://string-db.org/network/866895.HBHAL_4759Conserved hypothetical protein.
CCG47098.1 protein networkhttps://string-db.org/network/866895.HBHAL_4760Conserved hypothetical protein.
CCG47099.1 protein networkhttps://string-db.org/network/866895.HBHAL_4761Oxidoreductase, zinc-binding.
recQ protein networkhttps://string-db.org/network/866895.HBHAL_4762ATP-dependent DNA helicase RecQ.
kynU protein networkhttps://string-db.org/network/866895.HBHAL_4763Kynureninase; Catalyzes the cleavage of L-kynurenine (L-Kyn) and L-3- hydroxykynurenine (L-3OHKyn) into anthranilic acid (AA) and 3- hydroxyanthranilic acid (3-OHAA), respectively.
kynB protein networkhttps://string-db.org/network/866895.HBHAL_4764Kynurenine formamidase; Catalyzes the hydrolysis of N-formyl-L-kynurenine to L- kynurenine, the second step in the kynurenine pathway of tryptophan degradation.
CCG47103.1 protein networkhttps://string-db.org/network/866895.HBHAL_4765BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family.
CCG47104.1 protein networkhttps://string-db.org/network/866895.HBHAL_4766Hypothetical protein.
crtD protein networkhttps://string-db.org/network/866895.HBHAL_4767Amine oxidase.
ampS2 protein networkhttps://string-db.org/network/866895.HBHAL_4768M29 family aminopeptidase.
CCG47107.1 protein networkhttps://string-db.org/network/866895.HBHAL_4769ABC-type transport system ATP-binding protein.
CCG47108.1 protein networkhttps://string-db.org/network/866895.HBHAL_4770Alanine or glycine/cation symporter, AGCS family.
CCG47109.1 protein networkhttps://string-db.org/network/866895.HBHAL_4771ABC-type transport system extracellular binding protein (probable substrate iron(III)).
CCG47110.1 protein networkhttps://string-db.org/network/866895.HBHAL_4772ABC-type transport system permease protein (probable substrate iron(III)).
CCG47111.1 protein networkhttps://string-db.org/network/866895.HBHAL_4773ABC-type transport system ATP-binding protein (probable substrate iron(III)).
CCG47112.1 protein networkhttps://string-db.org/network/866895.HBHAL_4774acyl-CoA thioester hydrolase.
CCG47113.1 protein networkhttps://string-db.org/network/866895.HBHAL_4775Two-component sensor histidine kinase.
CCG47114.1 protein networkhttps://string-db.org/network/866895.HBHAL_4776Two-component response regulator.
CCG47115.1 protein networkhttps://string-db.org/network/866895.HBHAL_4777Serine protease.
CCG47116.1 protein networkhttps://string-db.org/network/866895.HBHAL_4778MerR family transcription regulator.
CCG47117.1 protein networkhttps://string-db.org/network/866895.HBHAL_4779Hypothetical protein.
cls2 protein networkhttps://string-db.org/network/866895.HBHAL_4780Cardiolipin synthetase; Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
CCG47119.1 protein networkhttps://string-db.org/network/866895.HBHAL_4781Conserved hypothetical protein.
CCG47120.1 protein networkhttps://string-db.org/network/866895.HBHAL_4782Sucrose-6-phosphate hydrolase; Enables the bacterium to metabolize sucrose as a sole carbon source; Belongs to the glycosyl hydrolase 32 family.
CCG47121.1 protein networkhttps://string-db.org/network/866895.HBHAL_4783Fructokinase; Belongs to the carbohydrate kinase PfkB family.
CCG47122.1 protein networkhttps://string-db.org/network/866895.HBHAL_4784PTS system subunit IIA, glucose-specific.
CCG47123.1 protein networkhttps://string-db.org/network/866895.HBHAL_4785Methionine gamma-lyase.
CCG47125.1 protein networkhttps://string-db.org/network/866895.HBHAL_4787Diguanylate phosphodiesterase domain protein.
CCG47126.1 protein networkhttps://string-db.org/network/866895.HBHAL_4788FAD-dependent oxidoreductase / Rieske-type iron-sulfur protein.
rarD protein networkhttps://string-db.org/network/866895.HBHAL_4789RarD protein.
CCG47128.1 protein networkhttps://string-db.org/network/866895.HBHAL_4790IS1341-type transposase.
CCG47129.1 protein networkhttps://string-db.org/network/866895.HBHAL_4791Conserved hypothetical protein.
CCG47130.1 protein networkhttps://string-db.org/network/866895.HBHAL_4792Hypothetical protein.
CCG47131.1 protein networkhttps://string-db.org/network/866895.HBHAL_4793TetR family transcription regulator.
CCG47132.1 protein networkhttps://string-db.org/network/866895.HBHAL_4794Hypothetical protein.
CCG47133.1 protein networkhttps://string-db.org/network/866895.HBHAL_4795FAD-dependent oxidoreductase.
CCG47134.1 protein networkhttps://string-db.org/network/866895.HBHAL_4796Aldo/keto reductase family protein.
CCG47135.1 protein networkhttps://string-db.org/network/866895.HBHAL_4797Hypothetical protein.
CCG47136.1 protein networkhttps://string-db.org/network/866895.HBHAL_4798ABC-type transport system ATP-binding protein.
CCG47137.1 protein networkhttps://string-db.org/network/866895.HBHAL_4799Hypothetical protein.
CCG47139.1 protein networkhttps://string-db.org/network/866895.HBHAL_4801O-acetylhomoserine sulfhydrylase.
metX protein networkhttps://string-db.org/network/866895.HBHAL_4802Homoserine O-acetyltransferase; Transfers an acetyl group from acetyl-CoA to L-homoserine, forming acetyl-L-homoserine.
CCG47141.1 protein networkhttps://string-db.org/network/866895.HBHAL_4803Putative carbohydrate esterase family 4 protein.
kynA protein networkhttps://string-db.org/network/866895.HBHAL_4804Tryptophan 2,3-dioxygenase; Heme-dependent dioxygenase that catalyzes the oxidative cleavage of the L-tryptophan (L-Trp) pyrrole ring and converts L- tryptophan to N-formyl-L-kynurenine. Catalyze [...]
yndH protein networkhttps://string-db.org/network/866895.HBHAL_4805Hypothetical protein.
CCG47144.1 protein networkhttps://string-db.org/network/866895.HBHAL_4806Hypothetical protein.
rpiA protein networkhttps://string-db.org/network/866895.HBHAL_4807Putative ribose 5-phosphate isomerase.
CCG47146.1 protein networkhttps://string-db.org/network/866895.HBHAL_4808Hypothetical protein.
CCG47147.1 protein networkhttps://string-db.org/network/866895.HBHAL_4809Two-component response regulator.
CCG47148.1 protein networkhttps://string-db.org/network/866895.HBHAL_4810Two-component sensor histidine kinase.
CCG47149.1 protein networkhttps://string-db.org/network/866895.HBHAL_4811Conserved hypothetical protein.
CCG47150.1 protein networkhttps://string-db.org/network/866895.HBHAL_4812Hypothetical protein.
CCG47151.1 protein networkhttps://string-db.org/network/866895.HBHAL_4813Hypothetical protein.
CCG47152.1 protein networkhttps://string-db.org/network/866895.HBHAL_4814M24 family peptidase; Belongs to the peptidase M24B family.
CCG47153.1 protein networkhttps://string-db.org/network/866895.HBHAL_4815Hypothetical protein.
CCG47154.1 protein networkhttps://string-db.org/network/866895.HBHAL_4816Glucose sorbosone dehydrogenase.
bioY1 protein networkhttps://string-db.org/network/866895.HBHAL_4817BioY family protein.
CCG47156.1 protein networkhttps://string-db.org/network/866895.HBHAL_4818Hypothetical protein.
CCG47157.1 protein networkhttps://string-db.org/network/866895.HBHAL_4819Hypothetical protein.
ypmR protein networkhttps://string-db.org/network/866895.HBHAL_4820Conserved hypothetical protein.
ypmS protein networkhttps://string-db.org/network/866895.HBHAL_4821Conserved hypothetical protein.
cysK2 protein networkhttps://string-db.org/network/866895.HBHAL_4822Cysteine synthase; Belongs to the cysteine synthase/cystathionine beta- synthase family.
yvgT protein networkhttps://string-db.org/network/866895.HBHAL_4823Hypothetical protein.
CCG47162.1 protein networkhttps://string-db.org/network/866895.HBHAL_4824Two-component hybrid sensor and regulator.
CCG47163.1 protein networkhttps://string-db.org/network/866895.HBHAL_4825Hypothetical protein.
yqjF protein networkhttps://string-db.org/network/866895.HBHAL_4826Conserved hypothetical protein.
ykcA protein networkhttps://string-db.org/network/866895.HBHAL_4827Glyoxalase domain protein.
CCG47166.1 protein networkhttps://string-db.org/network/866895.HBHAL_4828Aconitate hydratase.
npr4 protein networkhttps://string-db.org/network/866895.HBHAL_4829Neutral protease; Extracellular zinc metalloprotease.
CCG47168.1 protein networkhttps://string-db.org/network/866895.HBHAL_4830NprR family transcription regulator.
CCG47169.1 protein networkhttps://string-db.org/network/866895.HBHAL_4831Hypothetical protein.
CCG47170.1 protein networkhttps://string-db.org/network/866895.HBHAL_4832Hypothetical protein.
CCG47171.1 protein networkhttps://string-db.org/network/866895.HBHAL_4833Hypothetical protein.
treR protein networkhttps://string-db.org/network/866895.HBHAL_4834GntR family trehalose operon transcription repressor.
treA protein networkhttps://string-db.org/network/866895.HBHAL_4835Trehalose-6-phosphate hydrolase.
CCG47174.1 protein networkhttps://string-db.org/network/866895.HBHAL_4836PTS system subunit IIBC, trehalose-specific.
CCG47175.1 protein networkhttps://string-db.org/network/866895.HBHAL_4837PTS system subunit IIA, trehalose-specific.
CCG47176.1 protein networkhttps://string-db.org/network/866895.HBHAL_4838Conserved hypothetical protein.
yueJ protein networkhttps://string-db.org/network/866895.HBHAL_4839Pyrazinamidase / nicotinamidase.
CCG47178.1 protein networkhttps://string-db.org/network/866895.HBHAL_4840MFS-type transporter (probable metal-tetracycline-proton antiporter).
ybfQ protein networkhttps://string-db.org/network/866895.HBHAL_4841UPF0176 family protein; Belongs to the UPF0176 family.
CCG47180.1 protein networkhttps://string-db.org/network/866895.HBHAL_4842Hypothetical protein.
CCG47181.1 protein networkhttps://string-db.org/network/866895.HBHAL_4843Hypothetical protein; Belongs to the peptidase S51 family.
CCG47182.1 protein networkhttps://string-db.org/network/866895.HBHAL_4844Phosphomethylpyrimidine kinase.
CCG47183.1 protein networkhttps://string-db.org/network/866895.HBHAL_4844_AConserved hypothetical protein.
CCG47184.1 protein networkhttps://string-db.org/network/866895.HBHAL_4845Conserved hypothetical protein.
yhfK2 protein networkhttps://string-db.org/network/866895.HBHAL_4846Conserved hypothetical protein.
CCG47186.1 protein networkhttps://string-db.org/network/866895.HBHAL_4847NprR family transcription regulator.
ypcP protein networkhttps://string-db.org/network/866895.HBHAL_48485'-3' exonuclease family protein.
CCG47188.1 protein networkhttps://string-db.org/network/866895.HBHAL_4849Aldehyde dehydrogenase; Belongs to the aldehyde dehydrogenase family.
CCG47189.1 protein networkhttps://string-db.org/network/866895.HBHAL_4850Conserved hypothetical protein.
CCG47190.1 protein networkhttps://string-db.org/network/866895.HBHAL_4851AB hydrolase superfamily protein.
CCG47191.1 protein networkhttps://string-db.org/network/866895.HBHAL_4852Acetyltransferase, GNAT family.
CCG47192.1 protein networkhttps://string-db.org/network/866895.HBHAL_4853Putative oxidoreductase.
bioY2 protein networkhttps://string-db.org/network/866895.HBHAL_4854BioY family protein.
CCG47194.1 protein networkhttps://string-db.org/network/866895.HBHAL_4856Hypothetical protein.
CCG47195.1 protein networkhttps://string-db.org/network/866895.HBHAL_4857Hypothetical protein.
CCG47196.1 protein networkhttps://string-db.org/network/866895.HBHAL_4858Hypothetical protein.
CCG47197.1 protein networkhttps://string-db.org/network/866895.HBHAL_4859Hypothetical protein.
pabB protein networkhttps://string-db.org/network/866895.HBHAL_4860Para-aminobenzoate synthase subunit I.
trpG2 protein networkhttps://string-db.org/network/866895.HBHAL_4861Anthranilate synthase component II.
CCG47200.1 protein networkhttps://string-db.org/network/866895.HBHAL_4862Two-component sensor histidine kinase.
CCG47201.1 protein networkhttps://string-db.org/network/866895.HBHAL_4863Two-component response regulator.
CCG47202.1 protein networkhttps://string-db.org/network/866895.HBHAL_4864Hypothetical protein.
CCG47203.1 protein networkhttps://string-db.org/network/866895.HBHAL_4865Conserved hypothetical protein.
CCG47204.1 protein networkhttps://string-db.org/network/866895.HBHAL_4866MFS-type transporter.
CCG47205.1 protein networkhttps://string-db.org/network/866895.HBHAL_4867Hypothetical protein.
ykjE protein networkhttps://string-db.org/network/866895.HBHAL_4868NUDIX family hydrolase; Belongs to the Nudix hydrolase family.
ybbD protein networkhttps://string-db.org/network/866895.HBHAL_4869Family 3 glycoside hydrolase.
CCG47208.1 protein networkhttps://string-db.org/network/866895.HBHAL_4870Amidase; Belongs to the amidase family.
CCG47209.1 protein networkhttps://string-db.org/network/866895.HBHAL_4871Hypothetical protein.
CCG47210.1 protein networkhttps://string-db.org/network/866895.HBHAL_4873Conserved hypothetical protein.
yfmL protein networkhttps://string-db.org/network/866895.HBHAL_4874Probable ATP-dependent RNA helicase YfmL.
CCG47212.1 protein networkhttps://string-db.org/network/866895.HBHAL_4875Conserved hypothetical protein.
CCG47213.1 protein networkhttps://string-db.org/network/866895.HBHAL_4876Conserved hypothetical protein.
CCG47214.1 protein networkhttps://string-db.org/network/866895.HBHAL_4877Hypothetical protein.
CCG47215.1 protein networkhttps://string-db.org/network/866895.HBHAL_4878RDD domain protein.
CCG47216.1 protein networkhttps://string-db.org/network/866895.HBHAL_4879Pyridoxal-dependent decarboxylase; Belongs to the Orn/Lys/Arg decarboxylase class-II family.
CCG47217.1 protein networkhttps://string-db.org/network/866895.HBHAL_4880Hypothetical protein.
figA protein networkhttps://string-db.org/network/866895.HBHAL_4881Hypothetical protein.
CCG47219.1 protein networkhttps://string-db.org/network/866895.HBHAL_4882Hypothetical protein.
CCG47221.1 protein networkhttps://string-db.org/network/866895.HBHAL_4884Hypothetical protein.
argF protein networkhttps://string-db.org/network/866895.HBHAL_4885Ornithine carbamoyltransferase; Reversibly catalyzes the transfer of the carbamoyl group from carbamoyl phosphate (CP) to the N(epsilon) atom of ornithine (ORN) to produce L-citrulline.
carB2 protein networkhttps://string-db.org/network/866895.HBHAL_4886Carbamoyl phosphate synthase large subunit; Belongs to the CarB family.
carA2 protein networkhttps://string-db.org/network/866895.HBHAL_4887Carbamoyl phosphate synthase small subunit; Belongs to the CarA family.
argD protein networkhttps://string-db.org/network/866895.HBHAL_4888Acetylornithine aminotransferase; Belongs to the class-III pyridoxal-phosphate-dependent aminotransferase family. ArgD subfamily.
argB protein networkhttps://string-db.org/network/866895.HBHAL_4889Acetylglutamate kinase; Catalyzes the ATP-dependent phosphorylation of N-acetyl-L- glutamate; Belongs to the acetylglutamate kinase family. ArgB subfamily.
argJ protein networkhttps://string-db.org/network/866895.HBHAL_4890Glutamate N-acetyltransferase; Catalyzes two activities which are involved in the cyclic version of arginine biosynthesis: the synthesis of N-acetylglutamate from glutamate and acetyl-CoA as the [...]
argC protein networkhttps://string-db.org/network/866895.HBHAL_4891N-acetyl-gamma-glutamyl-phosphate reductase; Catalyzes the NADPH-dependent reduction of N-acetyl-5- glutamyl phosphate to yield N-acetyl-L-glutamate 5-semialdehyde. Belongs to the NAGSA dehydroge [...]
CCG47229.1 protein networkhttps://string-db.org/network/866895.HBHAL_4892NAD-dependent epimerase/dehydratase.
CCG47231.1 protein networkhttps://string-db.org/network/866895.HBHAL_4894Putative L-lysine 6-monooxygenase.
CCG47232.1 protein networkhttps://string-db.org/network/866895.HBHAL_4895Acetyltransferase, GNAT family.
CCG47233.1 protein networkhttps://string-db.org/network/866895.HBHAL_4896Spore germination protein KA.
CCG47234.1 protein networkhttps://string-db.org/network/866895.HBHAL_4897Spore germination protein KC.
CCG47235.1 protein networkhttps://string-db.org/network/866895.HBHAL_4898Hypothetical protein.
CCG47236.1 protein networkhttps://string-db.org/network/866895.HBHAL_4899Spore germination protein.
CCG47237.1 protein networkhttps://string-db.org/network/866895.HBHAL_4900Hypothetical protein.
CCG47238.1 protein networkhttps://string-db.org/network/866895.HBHAL_4901Hypothetical protein.
rluD4 protein networkhttps://string-db.org/network/866895.HBHAL_4902Pseudouridine synthase; Responsible for synthesis of pseudouridine from uracil. Belongs to the pseudouridine synthase RluA family.
CCG47240.1 protein networkhttps://string-db.org/network/866895.HBHAL_4903Phosphoesterase, PA-phosphatase related.
CCG47241.1 protein networkhttps://string-db.org/network/866895.HBHAL_4904ABC-type transport system ATP-binding/permease protein.
CCG47242.1 protein networkhttps://string-db.org/network/866895.HBHAL_4905ABC-type transport system ATP-binding/permease protein.
CCG47243.1 protein networkhttps://string-db.org/network/866895.HBHAL_4906Hypothetical protein.
CCG47244.1 protein networkhttps://string-db.org/network/866895.HBHAL_4907Hypothetical protein.
CCG47245.1 protein networkhttps://string-db.org/network/866895.HBHAL_4908Oxidoreductase.
CCG47246.1 protein networkhttps://string-db.org/network/866895.HBHAL_4909Putative oxidoreductase.
CCG47247.1 protein networkhttps://string-db.org/network/866895.HBHAL_4910Hypothetical protein.
CCG47248.1 protein networkhttps://string-db.org/network/866895.HBHAL_4911Conserved hypothetical protein.
CCG47249.1 protein networkhttps://string-db.org/network/866895.HBHAL_4912Aldehyde dehydrogenase.
hom2 protein networkhttps://string-db.org/network/866895.HBHAL_4913Homoserine dehydrogenase.
CCG47251.1 protein networkhttps://string-db.org/network/866895.HBHAL_4914Aminoacylase.
metB2 protein networkhttps://string-db.org/network/866895.HBHAL_4915Cystathionine gamma-synthase.
arcB protein networkhttps://string-db.org/network/866895.HBHAL_4916Ornithine cyclodeaminase.
CCG47254.1 protein networkhttps://string-db.org/network/866895.HBHAL_4917M24 family peptidase.
thrC3 protein networkhttps://string-db.org/network/866895.HBHAL_4918Threonine synthase.
CCG47257.1 protein networkhttps://string-db.org/network/866895.HBHAL_4920BCCT family transporter; Belongs to the BCCT transporter (TC 2.A.15) family.
CCG47258.1 protein networkhttps://string-db.org/network/866895.HBHAL_4921Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
thiE protein networkhttps://string-db.org/network/866895.HBHAL_4922Thiamine-phosphate synthase; Condenses 4-methyl-5-(beta-hydroxyethyl)thiazole monophosphate (THZ-P) and 2-methyl-4-amino-5-hydroxymethyl pyrimidine pyrophosphate (HMP-PP) to form thiamine monopho [...]
thiM protein networkhttps://string-db.org/network/866895.HBHAL_4923Hydroxyethylthiazole kinase; Catalyzes the phosphorylation of the hydroxyl group of 4- methyl-5-beta-hydroxyethylthiazole (THZ); Belongs to the Thz kinase family.
thiD protein networkhttps://string-db.org/network/866895.HBHAL_4924Phosphomethylpyrimidine kinase.
tenA protein networkhttps://string-db.org/network/866895.HBHAL_4925Thiaminase; Catalyzes an amino-pyrimidine hydrolysis reaction at the C5' of the pyrimidine moiety of thiamine compounds, a reaction that is part of a thiamine salvage pathway; Belongs to the TenA [...]
thiW protein networkhttps://string-db.org/network/866895.HBHAL_4926ThiW family protein.
CCG47264.1 protein networkhttps://string-db.org/network/866895.HBHAL_4927Hypothetical protein.
CCG47265.1 protein networkhttps://string-db.org/network/866895.HBHAL_4928PucR family transcription regulator.
CCG47266.1 protein networkhttps://string-db.org/network/866895.HBHAL_4929Threonine ammonia-lyase.
asnB protein networkhttps://string-db.org/network/866895.HBHAL_4930Asparagine synthase.
fic protein networkhttps://string-db.org/network/866895.HBHAL_4931Fic family protein.
CCG47269.1 protein networkhttps://string-db.org/network/866895.HBHAL_4932Hypothetical protein.
ykoV protein networkhttps://string-db.org/network/866895.HBHAL_4933Probable DNA repair protein YkoV; With LigD forms a non-homologous end joining (NHEJ) DNA repair enzyme, which repairs dsDNA breaks with reduced fidelity. Binds linear dsDNA with 5'- and 3'- over [...]
ligD protein networkhttps://string-db.org/network/866895.HBHAL_4934ATP-dependent DNA ligase.
CCG47272.1 protein networkhttps://string-db.org/network/866895.HBHAL_4935long-chain-fatty-acid--CoA ligase.
CCG47273.1 protein networkhttps://string-db.org/network/866895.HBHAL_4936Short-chain dehydrogenase/reductase family protein; Belongs to the short-chain dehydrogenases/reductases (SDR) family.
CCG47274.1 protein networkhttps://string-db.org/network/866895.HBHAL_4937acetyl-CoA acetyltransferase; Belongs to the thiolase-like superfamily. Thiolase family.
CCG47275.1 protein networkhttps://string-db.org/network/866895.HBHAL_4938acyl-CoA dehydrogenase.
ycsE protein networkhttps://string-db.org/network/866895.HBHAL_4940HAD superfamily hydrolase.
metQ3 protein networkhttps://string-db.org/network/866895.HBHAL_4941ABC-type transport system extracellular binding protein (probable substrate methionine); Belongs to the nlpA lipoprotein family.
metP3 protein networkhttps://string-db.org/network/866895.HBHAL_4942ABC-type transport system permease protein (probable substrate methionine).
metN3 protein networkhttps://string-db.org/network/866895.HBHAL_4943ABC-type transport system ATP-binding protein (probable substrate methionine); Part of the ABC transporter complex MetNIQ involved in methionine import. Responsible for energy coupling to the tra [...]
CCG47280.1 protein networkhttps://string-db.org/network/866895.HBHAL_4944Conserved hypothetical protein.
CCG47281.1 protein networkhttps://string-db.org/network/866895.HBHAL_4945Hypothetical protein.
CCG47282.1 protein networkhttps://string-db.org/network/866895.HBHAL_4946Hypothetical protein.
yrkE protein networkhttps://string-db.org/network/866895.HBHAL_4947Conserved hypothetical protein.
CCG47284.1 protein networkhttps://string-db.org/network/866895.HBHAL_4948Rhodanese domain protein.
yrkF protein networkhttps://string-db.org/network/866895.HBHAL_4949tusA/rhodanese domain protein; Belongs to the sulfur carrier protein TusA family.
CCG47286.1 protein networkhttps://string-db.org/network/866895.HBHAL_4950Metallo-beta-lactamase family protein.
yrkI protein networkhttps://string-db.org/network/866895.HBHAL_4951UPF0033 family protein; Belongs to the sulfur carrier protein TusA family.
yrkJ protein networkhttps://string-db.org/network/866895.HBHAL_4952UPF0721 family protein.
yqgS4 protein networkhttps://string-db.org/network/866895.HBHAL_4953yqgS family protein; Belongs to the LTA synthase family.
yjoA protein networkhttps://string-db.org/network/866895.HBHAL_4954Hypothetical protein.
CCG47291.1 protein networkhttps://string-db.org/network/866895.HBHAL_4955Conserved hypothetical protein.
CCG47292.1 protein networkhttps://string-db.org/network/866895.HBHAL_4956Homolog to PGA biosynthesis protein CapA.
cbaA protein networkhttps://string-db.org/network/866895.HBHAL_4958Cytochrome c oxidase subunit I; Belongs to the heme-copper respiratory oxidase family.
cbaB protein networkhttps://string-db.org/network/866895.HBHAL_4959Cytochrome c oxidase subunit II.
cbaD protein networkhttps://string-db.org/network/866895.HBHAL_4959_ACytochrome c oxidase subunit IIa.
CCG47297.1 protein networkhttps://string-db.org/network/866895.HBHAL_4960Two-component sensor histidine kinase.
nreA protein networkhttps://string-db.org/network/866895.HBHAL_4961Hypothetical protein.
CCG47299.1 protein networkhttps://string-db.org/network/866895.HBHAL_4962Two-component response regulator.
CCG47300.1 protein networkhttps://string-db.org/network/866895.HBHAL_4963Homolog to histidine kinase dimerisation domain.
CCG47301.1 protein networkhttps://string-db.org/network/866895.HBHAL_4964Hypothetical protein.
CCG47302.1 protein networkhttps://string-db.org/network/866895.HBHAL_4965Hypothetical protein.
HBHAL_4968 protein networkhttps://string-db.org/network/866895.HBHAL_4968Locus_tag: HBHAL_4967; product: ABC-type transport system ATP-binding protein (nonfunctional); gene has an in-frame stop codon; conceptual translation after in silico reconstruction: MERNLVVEDCKV [...]
CCG47306.1 protein networkhttps://string-db.org/network/866895.HBHAL_4969Hypothetical protein.
isp protein networkhttps://string-db.org/network/866895.HBHAL_4970Intracellular serine protease; Belongs to the peptidase S8 family.
CCG47308.1 protein networkhttps://string-db.org/network/866895.HBHAL_4971M23/M37 family peptidase.
ftsX protein networkhttps://string-db.org/network/866895.HBHAL_4972Cell-division protein; Part of the ABC transporter FtsEX involved in asymmetric cellular division facilitating the initiation of sporulation. Belongs to the ABC-4 integral membrane protein family [...]
CCG47310.1 protein networkhttps://string-db.org/network/866895.HBHAL_4973Hypothetical protein.
CCG47311.1 protein networkhttps://string-db.org/network/866895.HBHAL_4974Hypothetical protein.
racX protein networkhttps://string-db.org/network/866895.HBHAL_4975Aspartate racemase.
CCG47313.1 protein networkhttps://string-db.org/network/866895.HBHAL_4976UDP-N-acetylmuramyl-tripeptide synthetase; Belongs to the MurCDEF family. MurE subfamily.
CCG47314.1 protein networkhttps://string-db.org/network/866895.HBHAL_4977ATP-grasp domain protein.
CCG47315.1 protein networkhttps://string-db.org/network/866895.HBHAL_4978Hypothetical protein.
yqkA protein networkhttps://string-db.org/network/866895.HBHAL_4979Hypothetical protein.
CCG47317.1 protein networkhttps://string-db.org/network/866895.HBHAL_4980Peptidase.
katE protein networkhttps://string-db.org/network/866895.HBHAL_4981Catalase; Serves to protect cells from the toxic effects of hydrogen peroxide.
gltB1 protein networkhttps://string-db.org/network/866895.HBHAL_4982Glutamate synthase small subunit.
gltA protein networkhttps://string-db.org/network/866895.HBHAL_4983Glutamate synthase large subunit.
CCG47321.1 protein networkhttps://string-db.org/network/866895.HBHAL_4984S58/DmpA family peptidase.
yihY2 protein networkhttps://string-db.org/network/866895.HBHAL_4985YihY family protein; Belongs to the UPF0761 family.
sigL protein networkhttps://string-db.org/network/866895.HBHAL_4986RNA polymerase sigma factor SigL.
CCG47324.1 protein networkhttps://string-db.org/network/866895.HBHAL_4987Hypothetical protein.
CCG47325.1 protein networkhttps://string-db.org/network/866895.HBHAL_4988Pullulanase; Belongs to the glycosyl hydrolase 13 family.
glgP protein networkhttps://string-db.org/network/866895.HBHAL_4989Glycogen phosphorylase; Phosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural subst [...]
glgA protein networkhttps://string-db.org/network/866895.HBHAL_4990Glycogen synthase; Synthesizes alpha-1,4-glucan chains using ADP-glucose.
glgD protein networkhttps://string-db.org/network/866895.HBHAL_4991Glucose-1-phosphate adenylyltransferase subunit GlgD.
glgC protein networkhttps://string-db.org/network/866895.HBHAL_4992Glucose-1-phosphate adenylyltransferase; Involved in the biosynthesis of ADP-glucose, a building block required for the elongation reactions to produce glycogen. Catalyzes the reaction between AT [...]
glgB protein networkhttps://string-db.org/network/866895.HBHAL_4993Glycogen branching enzyme; Catalyzes the formation of the alpha-1,6-glucosidic linkages in glycogen by scission of a 1,4-alpha-linked oligosaccharide from growing alpha-1,4-glucan chains and the [...]
ytxG2 protein networkhttps://string-db.org/network/866895.HBHAL_4994UPF0478 family protein.
ytxG3 protein networkhttps://string-db.org/network/866895.HBHAL_4995UPF0478 family protein.
CCG47333.1 protein networkhttps://string-db.org/network/866895.HBHAL_4996Hypothetical protein.
CCG47334.1 protein networkhttps://string-db.org/network/866895.HBHAL_4997Hypothetical protein.
CCG47335.1 protein networkhttps://string-db.org/network/866895.HBHAL_4998Hypothetical protein.
CCG47336.1 protein networkhttps://string-db.org/network/866895.HBHAL_4999Sodium/dicarboxylate symporter family protein; Belongs to the dicarboxylate/amino acid:cation symporter (DAACS) (TC 2.A.23) family.
CCG47337.1 protein networkhttps://string-db.org/network/866895.HBHAL_5000IS150-type transposase orfAB.
CCG47338.1 protein networkhttps://string-db.org/network/866895.HBHAL_5002Isopentenyl-diphosphate delta-isomerase II 2.
CCG47339.1 protein networkhttps://string-db.org/network/866895.HBHAL_5003IS110-type transposase.
CCG47340.1 protein networkhttps://string-db.org/network/866895.HBHAL_5004MFS-type transporter.
uspA6 protein networkhttps://string-db.org/network/866895.HBHAL_5005UspA domain protein.
CCG47342.1 protein networkhttps://string-db.org/network/866895.HBHAL_5006FAD-dependent pyridine nucleotide-disulfide oxidoreductase.
CCG47343.1 protein networkhttps://string-db.org/network/866895.HBHAL_5007Hypothetical protein.
CCG47344.1 protein networkhttps://string-db.org/network/866895.HBHAL_5008Conserved hypothetical protein.
CCG47345.1 protein networkhttps://string-db.org/network/866895.HBHAL_5009Hypothetical protein.
CCG47346.1 protein networkhttps://string-db.org/network/866895.HBHAL_5010PadR family transcription regulator.
CCG47347.1 protein networkhttps://string-db.org/network/866895.HBHAL_5011Conserved hypothetical protein.
des protein networkhttps://string-db.org/network/866895.HBHAL_5012Delta5 acyl-lipid desaturase.
CCG47349.1 protein networkhttps://string-db.org/network/866895.HBHAL_5013Two-component sensor histidine kinase.
CCG47350.1 protein networkhttps://string-db.org/network/866895.HBHAL_5014Two-component response regulator.
CCG47351.1 protein networkhttps://string-db.org/network/866895.HBHAL_5016Conserved hypothetical protein.
dapA3 protein networkhttps://string-db.org/network/866895.HBHAL_5017Dihydrodipicolinate synthase; Catalyzes the condensation of (S)-aspartate-beta-semialdehyde [(S)-ASA] and pyruvate to 4-hydroxy-tetrahydrodipicolinate (HTPA).
CCG47353.1 protein networkhttps://string-db.org/network/866895.HBHAL_5018Hypothetical protein.
CCG47354.1 protein networkhttps://string-db.org/network/866895.HBHAL_5019Peptidoglycan-binding LysM.
CCG47355.1 protein networkhttps://string-db.org/network/866895.HBHAL_5020Branched-chain amino acid aminotransferase.
CCG47356.1 protein networkhttps://string-db.org/network/866895.HBHAL_5021Two-component response regulator.
CCG47357.1 protein networkhttps://string-db.org/network/866895.HBHAL_5022Two-component sensor histidine kinase.
CCG47358.1 protein networkhttps://string-db.org/network/866895.HBHAL_5023ABC-type transport system ATP-binding protein.
CCG47359.1 protein networkhttps://string-db.org/network/866895.HBHAL_5024ABC-type transport system permease protein.
ymdB protein networkhttps://string-db.org/network/866895.HBHAL_5025O-acetyl-ADP-ribose deacetylase.
CCG47361.1 protein networkhttps://string-db.org/network/866895.HBHAL_5026NUDIX family hydrolase.
CCG47362.1 protein networkhttps://string-db.org/network/866895.HBHAL_5027Hypothetical protein.
CCG47363.1 protein networkhttps://string-db.org/network/866895.HBHAL_5028Hypothetical protein.
yhjR protein networkhttps://string-db.org/network/866895.HBHAL_5029Conserved hypothetical protein.
CCG47365.1 protein networkhttps://string-db.org/network/866895.HBHAL_5030Conserved hypothetical protein.
CCG47366.1 protein networkhttps://string-db.org/network/866895.HBHAL_5031Hypothetical protein.
CCG47367.1 protein networkhttps://string-db.org/network/866895.HBHAL_5032Hypothetical protein.
CCG47368.1 protein networkhttps://string-db.org/network/866895.HBHAL_5033Conserved hypothetical protein.
lytE2 protein networkhttps://string-db.org/network/866895.HBHAL_5034Homolog to cell wall hydrolase LytE.
CCG47370.1 protein networkhttps://string-db.org/network/866895.HBHAL_5035Hypothetical protein.
CCG47371.1 protein networkhttps://string-db.org/network/866895.HBHAL_5036ABC-type transport system permease protein (probable substrate cobalt/nickel).
CCG47372.1 protein networkhttps://string-db.org/network/866895.HBHAL_5037ABC-type transport system ATP-binding protein (probable substrate cobalt/nickel).
CCG47373.1 protein networkhttps://string-db.org/network/866895.HBHAL_5038Hypothetical protein.
CCG47374.1 protein networkhttps://string-db.org/network/866895.HBHAL_5039RpiR family transcription regulator.
mqo protein networkhttps://string-db.org/network/866895.HBHAL_5040Malate dehydrogenase (quinone).
CCG47376.1 protein networkhttps://string-db.org/network/866895.HBHAL_5041Aldo/keto reductase family protein.
CCG47377.1 protein networkhttps://string-db.org/network/866895.HBHAL_5042Hypothetical protein.
CCG47378.1 protein networkhttps://string-db.org/network/866895.HBHAL_5043Hypothetical protein.
CCG47379.1 protein networkhttps://string-db.org/network/866895.HBHAL_5044Hypothetical protein.
CCG47380.1 protein networkhttps://string-db.org/network/866895.HBHAL_5045Hypothetical protein.
cls1 protein networkhttps://string-db.org/network/866895.HBHAL_5046Cardiolipin synthetase; Catalyzes the reversible phosphatidyl group transfer from one phosphatidylglycerol molecule to another to form cardiolipin (CL) (diphosphatidylglycerol) and glycerol.
CCG47382.1 protein networkhttps://string-db.org/network/866895.HBHAL_5047Conserved hypothetical protein.
CCG47383.1 protein networkhttps://string-db.org/network/866895.HBHAL_5048TetR family transcription regulator.
CCG47384.1 protein networkhttps://string-db.org/network/866895.HBHAL_5049MFS-type transporter.
CCG47385.1 protein networkhttps://string-db.org/network/866895.HBHAL_5050Hypothetical protein.
CCG47386.1 protein networkhttps://string-db.org/network/866895.HBHAL_5051Hypothetical protein.
CCG47387.1 protein networkhttps://string-db.org/network/866895.HBHAL_5052Hypothetical protein.
CCG47388.1 protein networkhttps://string-db.org/network/866895.HBHAL_5053SSS family transporter; Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.
CCG47389.1 protein networkhttps://string-db.org/network/866895.HBHAL_5054Conserved hypothetical protein.
lrgB protein networkhttps://string-db.org/network/866895.HBHAL_5055Hypothetical protein.
CCG47391.1 protein networkhttps://string-db.org/network/866895.HBHAL_5056Holin-like protein.
CCG47392.1 protein networkhttps://string-db.org/network/866895.HBHAL_5057Hypothetical protein.
CCG47393.1 protein networkhttps://string-db.org/network/866895.HBHAL_5058Diguanylate cyclase domain protein.
CCG47394.1 protein networkhttps://string-db.org/network/866895.HBHAL_5059Hypothetical protein.
CCG47395.1 protein networkhttps://string-db.org/network/866895.HBHAL_5060AB hydrolase superfamily protein.
CCG47397.1 protein networkhttps://string-db.org/network/866895.HBHAL_5062Homolog to ATP-dependent RNA helicase.
CCG47398.1 protein networkhttps://string-db.org/network/866895.HBHAL_5063Conserved hypothetical protein.
CCG47399.1 protein networkhttps://string-db.org/network/866895.HBHAL_5064Conserved hypothetical protein.
CCG47400.1 protein networkhttps://string-db.org/network/866895.HBHAL_5065Conserved hypothetical protein.
CCG47401.1 protein networkhttps://string-db.org/network/866895.HBHAL_5066Conserved hypothetical protein.
CCG47402.1 protein networkhttps://string-db.org/network/866895.HBHAL_5067Conserved hypothetical protein.
CCG47403.1 protein networkhttps://string-db.org/network/866895.HBHAL_5068Conserved hypothetical protein.
CCG47404.1 protein networkhttps://string-db.org/network/866895.HBHAL_5069Conserved hypothetical protein.
CCG47405.1 protein networkhttps://string-db.org/network/866895.HBHAL_5070Hypothetical protein.
CCG47406.1 protein networkhttps://string-db.org/network/866895.HBHAL_5071Hypothetical protein.
dnaC2 protein networkhttps://string-db.org/network/866895.HBHAL_5072Replicative DNA helicase; Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity. Belongs to the helicase family. DnaB subfamily.
CCG47408.1 protein networkhttps://string-db.org/network/866895.HBHAL_5073Hypothetical protein.
CCG47409.1 protein networkhttps://string-db.org/network/866895.HBHAL_5074Hypothetical protein.
yfjN protein networkhttps://string-db.org/network/866895.HBHAL_5076Hypothetical protein; Catalyzes the synthesis of 5,6-dihydrouridine (D), a modified base found in the D-loop of most tRNAs, via the reduction of the C5-C6 double bond in target uridines; Belongs [...]
CCG47413.1 protein networkhttps://string-db.org/network/866895.HBHAL_5078Hypothetical protein.
CCG47414.1 protein networkhttps://string-db.org/network/866895.HBHAL_5079Hypothetical protein.
CCG47415.1 protein networkhttps://string-db.org/network/866895.HBHAL_5079_AConserved hypothetical protein.
CCG47416.1 protein networkhttps://string-db.org/network/866895.HBHAL_5080Hypothetical protein.
CCG47417.1 protein networkhttps://string-db.org/network/866895.HBHAL_5081Hypothetical protein.
CCG47418.1 protein networkhttps://string-db.org/network/866895.HBHAL_5082Conserved hypothetical protein.
CCG47419.1 protein networkhttps://string-db.org/network/866895.HBHAL_5083Conserved hypothetical protein.
CCG47420.1 protein networkhttps://string-db.org/network/866895.HBHAL_5084Conserved hypothetical protein.
CCG47421.1 protein networkhttps://string-db.org/network/866895.HBHAL_5085Conserved hypothetical protein.
CCG47422.1 protein networkhttps://string-db.org/network/866895.HBHAL_5086Conserved hypothetical protein.
CCG47423.1 protein networkhttps://string-db.org/network/866895.HBHAL_5087Hypothetical protein.
CCG47424.1 protein networkhttps://string-db.org/network/866895.HBHAL_5088ABC-type transport system ATP-binding protein.
CCG47425.1 protein networkhttps://string-db.org/network/866895.HBHAL_5089ABC-type transport system permease protein.
HBHAL_5090 protein networkhttps://string-db.org/network/866895.HBHAL_5090Locus_tag: HBHAL_5089_A; product: conserved hypothetical protein (nonfunctional); gene has a frameshift; conceptual translation after in silico reconstruction: MNCHGHQRRIDLVKNYNIVPITHTRLLNGHQLSSC [...]
CCG47428.1 protein networkhttps://string-db.org/network/866895.HBHAL_5091Conserved hypothetical protein.
alr2 protein networkhttps://string-db.org/network/866895.HBHAL_5092Alanine racemase; Catalyzes the interconversion of L-alanine and D-alanine. May also act on other amino acids; Belongs to the alanine racemase family.
ald3 protein networkhttps://string-db.org/network/866895.HBHAL_5093Alanine dehydrogenase; Belongs to the AlaDH/PNT family.
yukF protein networkhttps://string-db.org/network/866895.HBHAL_5094Hypothetical protein.
CCG47432.1 protein networkhttps://string-db.org/network/866895.HBHAL_5095Hypothetical protein.
yydA protein networkhttps://string-db.org/network/866895.HBHAL_5096Conserved hypothetical protein; Specifically methylates the pseudouridine at position 1915 (m3Psi1915) in 23S rRNA; Belongs to the RNA methyltransferase RlmH family.
CCG47434.1 protein networkhttps://string-db.org/network/866895.HBHAL_5097Oxidoreductase.
CCG47435.1 protein networkhttps://string-db.org/network/866895.HBHAL_5098ABC-type transport system extracellular binding protein (probable substrate ribose).
CCG47436.1 protein networkhttps://string-db.org/network/866895.HBHAL_5099ABC-type transport system permease protein (probable substrate ribose); Belongs to the binding-protein-dependent transport system permease family.
rbsA protein networkhttps://string-db.org/network/866895.HBHAL_5100ABC-type transport system ATP-binding protein (probable substrate ribose); Part of the ABC transporter complex RbsABC involved in ribose import. Responsible for energy coupling to the transport s [...]
rbsD protein networkhttps://string-db.org/network/866895.HBHAL_5101High affinity ribose transport protein RbsD; Catalyzes the interconversion of beta-pyran and beta-furan forms of D-ribose.
rbsK protein networkhttps://string-db.org/network/866895.HBHAL_5102Ribokinase; Catalyzes the phosphorylation of ribose at O-5 in a reaction requiring ATP and magnesium. The resulting D-ribose-5-phosphate can then be used either for sythesis of nucleotides, histi [...]
rbsR protein networkhttps://string-db.org/network/866895.HBHAL_5103LacI family ribose operon repressor.
CCG47441.1 protein networkhttps://string-db.org/network/866895.HBHAL_5104M48 family peptidase.
CCG47442.1 protein networkhttps://string-db.org/network/866895.HBHAL_5105Hypothetical protein.
CCG47443.1 protein networkhttps://string-db.org/network/866895.HBHAL_5106NUDIX family hydrolase; Belongs to the Nudix hydrolase family.
mtnN3 protein networkhttps://string-db.org/network/866895.HBHAL_5109FAD-dependent pyridine nucleotide-disulphide oxidoreductase (nonfunctional).
CCG47446.1 protein networkhttps://string-db.org/network/866895.HBHAL_5110Hypothetical protein.
CCG47447.1 protein networkhttps://string-db.org/network/866895.HBHAL_5111Hypothetical protein.
CCG47448.1 protein networkhttps://string-db.org/network/866895.HBHAL_5112Hypothetical protein.
gly1 protein networkhttps://string-db.org/network/866895.HBHAL_5113Threonine aldolase.
CCG47450.1 protein networkhttps://string-db.org/network/866895.HBHAL_5114Conserved hypothetical protein.
yyxA protein networkhttps://string-db.org/network/866895.HBHAL_5115Serine protease.
yycJ protein networkhttps://string-db.org/network/866895.HBHAL_5116Hypothetical protein.
CCG47453.1 protein networkhttps://string-db.org/network/866895.HBHAL_5117Hypothetical protein.
yycH protein networkhttps://string-db.org/network/866895.HBHAL_5118Hypothetical protein.
CCG47455.1 protein networkhttps://string-db.org/network/866895.HBHAL_5119Two-component sensor histidine kinase.
CCG47456.1 protein networkhttps://string-db.org/network/866895.HBHAL_5120Two-component response regulator.
CCG47457.1 protein networkhttps://string-db.org/network/866895.HBHAL_5121M23 family peptidase.
CCG47458.1 protein networkhttps://string-db.org/network/866895.HBHAL_5122Hypothetical protein.
CCG47459.1 protein networkhttps://string-db.org/network/866895.HBHAL_5123Hypothetical protein.
CCG47460.1 protein networkhttps://string-db.org/network/866895.HBHAL_5124Putative decarboxylase; Belongs to the LOG family.
purA protein networkhttps://string-db.org/network/866895.HBHAL_5125Adenylosuccinate synthetase; Plays an important role in the de novo pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP; Belongs to t [...]
CCG47462.1 protein networkhttps://string-db.org/network/866895.HBHAL_5126DeoR family transcription regulator.
ywpJ protein networkhttps://string-db.org/network/866895.HBHAL_5127Probable phosphatase YwpJ.
dnaC1 protein networkhttps://string-db.org/network/866895.HBHAL_5129Replicative DNA helicase; Participates in initiation and elongation during chromosome replication; it exhibits DNA-dependent ATPase activity. Belongs to the helicase family. DnaB subfamily.
rplI protein networkhttps://string-db.org/network/866895.HBHAL_513050S ribosomal protein L9; Binds to the 23S rRNA.
yybT protein networkhttps://string-db.org/network/866895.HBHAL_5131DHH subfamily 1 protein; Has phosphodiesterase (PDE) activity against cyclic-di-AMP (c-di-AMP); Belongs to the GdpP/PdeA phosphodiesterase family.
CCG47468.1 protein networkhttps://string-db.org/network/866895.HBHAL_5132Hypothetical protein.
hisJ2 protein networkhttps://string-db.org/network/866895.HBHAL_5133Histidinol-phosphatase; Belongs to the PHP hydrolase family. HisK subfamily.
CCG47470.1 protein networkhttps://string-db.org/network/866895.HBHAL_5134AbgT family protein.
CCG47471.1 protein networkhttps://string-db.org/network/866895.HBHAL_5135Putative oxidoreductase.
serA protein networkhttps://string-db.org/network/866895.HBHAL_5136Phosphoglycerate dehydrogenase; Belongs to the D-isomer specific 2-hydroxyacid dehydrogenase family.
CCG47473.1 protein networkhttps://string-db.org/network/866895.HBHAL_5137Aminotransferase.
CCG47474.1 protein networkhttps://string-db.org/network/866895.HBHAL_5138ABC-type transport system extracellular binding protein (probable substrate peptide/nickel).
yyaS1 protein networkhttps://string-db.org/network/866895.HBHAL_5139Conserved hypothetical protein.
hmp protein networkhttps://string-db.org/network/866895.HBHAL_5140Nitric oxide dioxygenase; Is involved in NO detoxification in an aerobic process, termed nitric oxide dioxygenase (NOD) reaction that utilizes O(2) and NAD(P)H to convert NO to nitrate, which pro [...]
nsrR protein networkhttps://string-db.org/network/866895.HBHAL_5141Transcription regulator NsrR.
rpsR protein networkhttps://string-db.org/network/866895.HBHAL_514230S ribosomal protein S18; Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit; Belongs to the bacterial ribosom [...]
ssb protein networkhttps://string-db.org/network/866895.HBHAL_5143Single-strand DNA-binding protein; Plays an important role in DNA replication, recombination and repair. Binds to ssDNA and to an array of partner proteins to recruit them to their sites of actio [...]
rpsF protein networkhttps://string-db.org/network/866895.HBHAL_514430S ribosomal protein S6; Binds together with S18 to 16S ribosomal RNA.
ychF protein networkhttps://string-db.org/network/866895.HBHAL_5145Translation-associated GTPase; ATPase that binds to both the 70S ribosome and the 50S ribosomal subunit in a nucleotide-independent manner.
CCG47482.1 protein networkhttps://string-db.org/network/866895.HBHAL_5146Hypothetical protein.
CCG47483.1 protein networkhttps://string-db.org/network/866895.HBHAL_5147Small-conductance mechanosensitive channel.
yyaD protein networkhttps://string-db.org/network/866895.HBHAL_5148Hypothetical protein.
CCG47485.1 protein networkhttps://string-db.org/network/866895.HBHAL_5149Conserved hypothetical protein.
ydfK protein networkhttps://string-db.org/network/866895.HBHAL_5150Conserved hypothetical protein.
CCG47487.1 protein networkhttps://string-db.org/network/866895.HBHAL_5151Stage 0 sporulation protein J; Belongs to the ParB family.
noc protein networkhttps://string-db.org/network/866895.HBHAL_5152Nucleoid occlusion protein; Effects nucleoid occlusion by binding relatively nonspecifically to DNA and preventing the assembly of the division machinery in the vicinity of the nucleoid, especial [...]
CCG47489.1 protein networkhttps://string-db.org/network/866895.HBHAL_5153Hypothetical protein.
CCG47490.1 protein networkhttps://string-db.org/network/866895.HBHAL_5154MFS-type transporter.
prtV protein networkhttps://string-db.org/network/866895.HBHAL_5155M6 family peptidase.
CCG47492.1 protein networkhttps://string-db.org/network/866895.HBHAL_5156Two-component response regulator.
CCG47493.1 protein networkhttps://string-db.org/network/866895.HBHAL_5157Two-component sensor histidine kinase.
CCG47494.1 protein networkhttps://string-db.org/network/866895.HBHAL_5158ABC-type transport system permease protein (probable substrate antibiotic).
CCG47495.1 protein networkhttps://string-db.org/network/866895.HBHAL_5159ABC-type transport system ATP-binding protein (probable substrate antibiotic).
CCG47496.1 protein networkhttps://string-db.org/network/866895.HBHAL_5160Acetyltransferase, GNAT family.
CCG47497.1 protein networkhttps://string-db.org/network/866895.HBHAL_5161Conserved hypothetical protein.
CCG47498.1 protein networkhttps://string-db.org/network/866895.HBHAL_5162Spore photoproduct lyase.
CCG47499.1 protein networkhttps://string-db.org/network/866895.HBHAL_5163Short-chain dehydrogenase/reductase family protein.
nei protein networkhttps://string-db.org/network/866895.HBHAL_5164Endonuclease VIII.
CCG47501.1 protein networkhttps://string-db.org/network/866895.HBHAL_5165Probable phosphoesterase.
gidB protein networkhttps://string-db.org/network/866895.HBHAL_5166Glucose-inhibited division protein B; Specifically methylates the N7 position of guanine in position 535 of 16S rRNA; Belongs to the methyltransferase superfamily. RNA methyltransferase RsmG fami [...]
gidA protein networkhttps://string-db.org/network/866895.HBHAL_5167tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; NAD-binding protein involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain t [...]
mnmE protein networkhttps://string-db.org/network/866895.HBHAL_5168tRNA modification GTPase TrmE; Exhibits a very high intrinsic GTPase hydrolysis rate. Involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain t [...]
jag protein networkhttps://string-db.org/network/866895.HBHAL_5170Protein Jag.
yidC-2 protein networkhttps://string-db.org/network/866895.HBHAL_5171OxaA-like protein precursor; Required for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integration of membrane protein [...]
rnpA protein networkhttps://string-db.org/network/866895.HBHAL_5172Ribonuclease P; RNaseP catalyzes the removal of the 5'-leader sequence from pre-tRNA to produce the mature 5'-terminus. It can also cleave other RNA substrates such as 4.5S RNA. The protein compo [...]
rpmH protein networkhttps://string-db.org/network/866895.HBHAL_517350S ribosomal protein L34; Belongs to the bacterial ribosomal protein bL34 family.